KEGG   Felis catus (domestic cat): 101084060
Entry
101084060         CDS       T02385                                 
Symbol
IRF7
Name
(RefSeq) interferon regulatory factor 7 isoform X1
  KO
K09447  interferon regulatory factor 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101084060 (IRF7)
   04621 NOD-like receptor signaling pathway
    101084060 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    101084060 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    101084060 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101084060 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101084060 (IRF7)
   05160 Hepatitis C
    101084060 (IRF7)
   05164 Influenza A
    101084060 (IRF7)
   05162 Measles
    101084060 (IRF7)
   05168 Herpes simplex virus 1 infection
    101084060 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101084060 (IRF7)
   05169 Epstein-Barr virus infection
    101084060 (IRF7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101084060 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101084060 (IRF7)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101084060 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 101084060
NCBI-ProteinID: XP_011285475
Ensembl: ENSFCAG00000031821
UniProt: A0A337S7B8
LinkDB
Position
D1:complement(117316222..117319361)
AA seq 512 aa
MAAAPERGPPRPRFADWLLGEVGSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADARIF
KAWAVARGRWPPSNSGSDQLASEGPLRASWKTNFRCALHSTQRFVMLQDNSGDPTDPHKV
YALSSAPGWREGPGTNQGDEKAPEDARPLMGGLPRPCPAGAAAEREGPRLSSEPCAPSSP
LGPAGNAGDLLLQALEQSCLEDHLLEAAWGLDPIPPEVPGPALPNMVPYLPRAVETAPSP
RLQALQQAQVTDAGPAPALEPWQPPREAAPGIRTAGEVVAGPGRSQIGSQAEPSPGALEV
TIMYKGRTVLQETVRRPSFVFLYGSPSPAAEAAEPQHVAFPSPAELPDQKQLHYTEKLLQ
HVAPGLQLELRGPRLWARRLGKCKVYWEVGGPLGSASPSTPPCLLQRNQDTPIFDFSAFF
RELVEFRACRRRRSPHYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRAHLEYVQREGVS
SLDSSSLGLCLSSCNSLYEALEHFLMEVEQPA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggccgcggctcccgaaagggggcccccgcgcccgcggttcgcggactggcttctgggg
gaggtcggcagcggccgctacgaaggcctgcggtggctggacgcggcccgcacgcgcttc
cgcgtgccttggaagcacttcgcgcggaaggacctgggcgaggccgacgcgcgcatcttc
aaggcctgggccgtggcccgcggcaggtggccgcccagcaacagcggaagtgaccagctg
gcttccgaaggcccgctccgcgccagctggaaaaccaacttccgctgtgcgctgcacagc
acccagcgctttgtgatgctgcaagacaactcgggggaccccaccgacccgcataaggtg
tacgcgctcagctccgcaccggggtggagagaaggcccaggcactaaccagggggacgag
aaggccccggaagacgcccgacccttgatgggtgggctccctaggccgtgcccggcggga
gctgctgctgagagggaggggcccaggctgagctctgagccctgtgcccccagctcccct
ttgggccctgctggcaatgctggggacctcttgctccaggctctggagcagagctgcctg
gaggaccatctgctggaagctgcatgggggttggaccctatccccccggaggtccctggc
ccagcgctccccaacatggtgccatacctgcctagggcagtggagacagcccccagcccc
aggctgcaggccctgcagcaggcccaggtgacagacgcaggcccggccccagccctggag
ccctggcagcccccacgggaggcggcgcctggcatccggacggcaggtgaggtcgtggcc
gggcccggccgctcacagatcgggtcacaggcagagcccagcccgggggccctggaggtg
accatcatgtacaagggccgcacagtgctgcaggagacggtgaggcgtccgagcttcgtg
tttctgtatgggtcccccagcccagccgccgaggccgcagagccccagcacgtggccttc
ccgagcccggcggagctcccggaccagaagcagcttcactacacagagaagctcttgcag
cacgtggcccccggcctgcagctggagctccgggggcccaggctgtgggcgcggcgcctg
ggcaaatgcaaggtctactgggaggtgggcgggcccctgggctccgccagcccctccacg
cccccgtgcctgctgcaaaggaaccaggacacccccatcttcgacttcagcgccttcttc
cgagagctggtagagttccgggcttgccggcgtcggcgctccccgcactacaccatctac
ctgggctttgggcaggacctgtcggctgggaggcccaaggagaagagcctggtcctggtg
aagctggagccgtggctgtgccgggcgcacctggagtacgtgcagcgagaaggcgtgtcc
tccctggacagcagcagcctcggcctctgcctgtccagctgcaacagcctctacgaggcc
ctggagcacttcctcatggaggtggaacagcccgcctaa

DBGET integrated database retrieval system