KEGG   Felis catus (domestic cat): 101084327
Entry
101084327         CDS       T02385                                 
Symbol
CCR7
Name
(RefSeq) C-C chemokine receptor type 7
  KO
K04182  C-C chemokine receptor type 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101084327 (CCR7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101084327 (CCR7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101084327 (CCR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101084327 (CCR7)
   04050 Cytokine receptors [BR:fca04050]
    101084327 (CCR7)
   04090 CD molecules [BR:fca04090]
    101084327 (CCR7)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101084327 (CCR7)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   101084327 (CCR7)
CD molecules [BR:fca04090]
 Proteins
  101084327 (CCR7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 101084327
NCBI-ProteinID: XP_003996882
UniProt: A0A2I2V2J2
LinkDB
Position
E1:complement(41455607..41470014)
AA seq 379 aa
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWF
LPVMYSVICFMGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAMADILFLLTLPFWAYSAAK
SWAFGVHICKIIFGIYKISFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLFISKLSCV
GIWMLAMVLSTPELMYSGLQKSSSEQALRCSLITEHVEALITIQVAQMVVGFLIPLGAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIAFQLPYNGVVLAQTVANFNITGSGSCE
LSKQLDIAYDITYSLACVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRQWSSCR
HTRRSSMSVEAETTTTFSP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggacctggggaaaccaatgaaaagcgtgctggtggtggctctccttgtcattttccag
gtgtgcctatgccaagatgaggtcacagatgattacatcggagaaaataccacggtggac
tacacgctgtatgagtccgtatgcttcaagaaagacgtgcggaactttaaagcctggttc
ctgccagtcatgtactccgtcatctgtttcatgggtctgctgggcaacgggctggttgtg
ctgacctacatctatttcaagaggctcaagaccatgaccgatacctacctgctcaacctg
gccatggcagacatcctcttcctcctgacccttcccttctgggcctacagcgcggccaag
tcctgggccttcggcgtccacatttgcaagatcatctttggcatctacaagataagcttc
ttcagcggcatgttgctgcttctttgtatcagcattgaccgctacgtggccattgtccag
gccgtgtcggcccaccgacaccgcgcccgcgtccttttcatcagcaagctctcctgtgtg
ggcatctggatgctggccatggtgctgtccaccccagagctgatgtacagcggcctccag
aagagcagcagcgaacaagcactgcggtgctccctcatcactgagcacgtggaagccctg
atcaccatccaggtggcccagatggtggtgggctttctgatccccttgggggccatgagc
ttctgctacctcgtcatcatccgcaccctgctccaggcacgcaactttgagcgcaacaaa
gccatcaaggtcatcatcgctgtggtcgtggtctttatagccttccagctgccctacaat
ggggtggtcctggcccagacggtggccaacttcaatatcaccggcagcggcagctgtgag
ctcagcaagcagctcgacatcgcctacgacatcacctacagcctggcctgcgtccgctgc
tgcgtcaaccctttcttatacgctttcattggcgtcaagttcagaagcgatctcttcaaa
ctcttcaaggacttgggctgcctgagccaggagcggctccgtcagtggtcttcctgccgc
cacacccggcgctcctccatgagtgtggaggctgagaccaccactaccttctccccgtag

KEGG   Felis catus (domestic cat): 101088872
Entry
101088872         CDS       T02385                                 
Symbol
ACKR4
Name
(RefSeq) atypical chemokine receptor 4
  KO
K04186  atypical chemokine receptor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101088872 (ACKR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101088872 (ACKR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101088872 (ACKR4)
   04050 Cytokine receptors [BR:fca04050]
    101088872 (ACKR4)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101088872 (ACKR4)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   101088872 (ACKR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 101088872
NCBI-ProteinID: XP_003992166
Ensembl: ENSFCAG00000003875
UniProt: M3W144
LinkDB
Position
C2:complement(132435069..132440260)
AA seq 350 aa
MALEHNQSTDYYYEENEVNGTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFIIGIAGNS
IVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGRIMCKVTSALYT
VNFVSGMQFLACISIDRYWAVTKAPSQSGVGKPCWLICFFVWMVAILLSIPQLVFYTVNH
KARCIPIFPYHLGTSVKASIQMLEICIGFVIPFLIMGVCYFVTARTLIRMPNIKKSRPLK
VLLTVVIVFIVTQLPYNIVRFCQVIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNP
VLYVFMGASFKNYIMKVAKKYGSWRRQRQNVDEIPFDSEDPTEPTSTFSI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggctttggaacacaaccagtcaacagattactattatgaggaaaatgaagtgaatggc
actcatgactatagtcagtatgaagtgatctgtataaaagaagaagtcagaaaatttgca
aaagtcttcctgcctgccttcttcacaatagctttcatcattggaattgcaggcaattcc
atagtagtggcgatttatgcctattacaagaaacagagaaccaaaacagatgtgtacatc
ctgaatttggcagtggcagatttactccttctatttactctgcctttttgggcagttaat
gcagttcatgggtgggttttagggagaatcatgtgcaaagtcacttcagccttgtacact
gtcaatttcgtctctggaatgcagtttctggcttgtatcagcatagacagatattgggcc
gtaacgaaagccccaagccaatcaggagtggggaaaccatgctggcttatctgtttcttt
gtctggatggttgccatcttgctgagtataccacagctggttttttatacagtaaatcac
aaggctaggtgcattcccatctttccatatcacctaggaacatcagtgaaagcatcaatt
caaatgttggaaatctgcattggatttgtaataccctttcttattatgggagtatgctac
tttgtcacagcaaggacactcatcaggatgcccaacattaaaaaatctcgacccctcaaa
gttctgctcacggtggtgatagttttcattgtcactcagctgccttataacattgtcagg
ttctgccaagtcatagacatcatctactccctgatcactgactgtgacatgagcaaacgc
atggatgttgccatccaaatcacagagagcatcgcactctttcacagctgcctcaaccca
gtcctgtatgtttttatgggagcatcgtttaaaaactacatcatgaaagttgccaagaaa
tatgggtcctggagaagacaaagacaaaacgtggacgagattccttttgactcagaagat
cctacagagccaaccagtacttttagcatttaa

DBGET integrated database retrieval system