KEGG   Felis catus (domestic cat): 101084403
Entry
101084403         CDS       T02385                                 
Symbol
PECAM1
Name
(RefSeq) platelet endothelial cell adhesion molecule isoform X1
  KO
K06471  platelet/endothelial cell adhesion molecule
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04670  Leukocyte transendothelial migration
fca05144  Malaria
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101084403 (PECAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101084403 (PECAM1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101084403 (PECAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101084403 (PECAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101084403 (PECAM1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101084403 (PECAM1)
   04091 Lectins [BR:fca04091]
    101084403 (PECAM1)
CD molecules [BR:fca04090]
 Proteins
  101084403 (PECAM1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   101084403 (PECAM1)
Lectins [BR:fca04091]
 I-type lectins (Siglecs)
  101084403 (PECAM1)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig I-set MAP17 Shisa DUF6314
Other DBs
NCBI-GeneID: 101084403
NCBI-ProteinID: XP_006940558
Ensembl: ENSFCAG00000003509
UniProt: A0A5F5XDL5
LinkDB
Position
E1:complement(48487833..48548761)
AA seq 764 aa
MQPETAQDGKMWLGVLLALMLCPGLEGQENPFTINYIHMNILPGLEVQNGENLTLQCVVD
ISTTSHVKPQHWVLFYKDDVLFHNVSSMKNTESYFIPQARVCDAGTYKCTVILNNKEKTT
LEYQVWVKGVSDPRVTLDKKEAIEGGVVTVNCSVPEENPPIYFTIEKLKLDAKGFKQKRE
KVSQNQNFMVMEFTVEEQDHVILFQCQARIFSGTNVEISKAIRSELVTVTESFSNPRFHI
SPKGVITEGDQLNIKCTIQVTHLVQSFPEIIIQKDKAIVAHKTHGNEATYSVMAMVEHSG
NYTCKVEASRISKVSSIVVNITELFSKPKLESSATRLDHGESLNLWCSIPGAPPANFTIQ
KENTIVSLSQNFTKIASERDRGTYTCNAGIGKVVKKSNAVQITVCEMLSKPRIFYDSGPE
VIKGQTIAVSCQSVNGTAPISYHLVKANSILESCNMDSNEPAVFKDKPTKDVEYQCIADN
CHSHTEMISEVLRVKVIAPVDQVKLTILLNEEVESGKEVVLRCSVNDASGPITYRFYREK
EGSPFYQIISNDTYAIWHKDKASKEHEGQYYCTAFNRANLVKSNPQSNILTVRVFLAPWK
KGLIAVVVIGVIIATLILGARCCFLKKAKAKQTPVEMARPAAPLLNSSNEKMLSDPDTEA
NRHYGYSEDVGNHAMKPANENKEPLTMDVEYTEVQVTPSEPYQEKNRSQNKAPSGNIPDS
RDKQPAGLGLETKGTETVYSEIRKTNPDFVENRYSRTEGSLDGT
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgcagccggagacagcccaagacggcaagatgtggctcggagtgctgctggcacttatg
ctttgtccaggccttgaaggacaagaaaaccccttcaccatcaactacatccacatgaat
atcctgccaggactggaggtgcaaaatggggagaacctgaccctgcagtgcgtcgtggac
atcagcaccacctcccatgtcaagcctcagcactgggtgctgttctataaggatgatgtg
ctgtttcacaacgtctcctccatgaagaacacggagagttattttattccccaagcccgg
gtctgtgatgcagggacatataaatgcaccgtgattctgaacaacaaggagaaaaccaca
ttggagtaccaggtgtgggtgaaaggagtgtccgatcccagagtgacactggacaagaaa
gaggcaatagaaggcggggtcgtgacggtcaattgttctgtcccagaggaaaatccccca
atatacttcacaattgaaaaactcaagctagatgcaaaaggtttcaagcaaaaaagagaa
aaagtttctcagaaccagaattttatggtgatggaattcacagtggaggaacaggaccat
gtcatattgttccaatgtcaagccaggatcttttctgggaccaatgtggagatctctaaa
gccatcaggagtgaactggtcaccgtgacggaatccttctctaatcccagattccacatc
agccccaagggagtgatcacagaaggagatcagctcaacattaagtgcaccattcaagtg
acacacctggtgcagtcatttccagaaatcataatccagaaggacaaggcgattgtagca
cacaagacacatggcaatgaggccacctactcagtgatggccatggtggagcatagtggc
aactacacgtgcaaagtggaagccagccggatatccaaggtcagcagcatcgtggtcaac
ataacagagctgttttccaagccgaagctggaatcttccgccacccgcctagatcacggt
gaaagcctgaacctgtggtgctccattccaggagcacctccagccaactttaccatccag
aaggaaaacacgattgtgtcactgtctcaaaatttcaccaagatagcctcagagagggac
agagggacatacacctgcaatgcaggcattggcaaggtggtcaagaaaagcaatgcagtc
cagataactgtgtgtgaaatgctctccaagcccaggattttttatgactccggccctgag
gtgataaaaggacagaccatagcagtcagttgccagtccgtaaatggaaccgcacctatt
agctatcaccttgtaaaagcaaatagcattttggagagttgtaacatggactccaatgag
cctgcggtattcaaagacaagccaacaaaagatgtagaataccaatgtatcgcagataat
tgtcattcccatactgaaatgatcagtgaagttctgcgggtcaaggtgatagcccccgtg
gatcaggtcaagctcactatcctgctgaatgaagaggtggagtctgggaaggaggttgtg
cttcggtgctccgtgaatgatgcctctggtcccatcacctacaggttttacagagaaaag
gagggcagtcccttctaccagatcatttcaaatgatacctatgccatttggcacaaggac
aaggctagcaaggaacatgagggacaatattactgcacagccttcaacagagccaacctt
gttaaaagcaatccccaaagcaacatactgacagtcagagtctttcttgccccatggaag
aaaggacttattgccgtggttgtcatcggagtgataattgccaccttgatacttggagcc
agatgctgttttctgaagaaagccaaggccaagcagacgccagtggagatggccaggcca
gcagcgccacttctgaattccagcaatgagaagatgttgtcagatcccgataccgaagcc
aacagacattacggttacagtgaagatgttggaaaccatgcaatgaaaccagcaaatgaa
aataaagagcctctgaccatggatgtggaatacacagaagtgcaagtgaccccatctgag
ccttaccaagagaaaaacaggagccaaaataaagcaccatccggaaacatccctgacagc
agagacaaacagcctgctggcctgggtctggaaaccaagggcacagagacggtgtatagt
gaaatccggaaaactaatcctgatttcgtggaaaacagatattctagaacggaaggctcc
cttgatggaacttag

DBGET integrated database retrieval system