KEGG   Felis catus (domestic cat): 101084615
Entry
101084615         CDS       T02385                                 
Symbol
BCL2L11
Name
(RefSeq) bcl-2-like protein 11 isoform X2
  KO
K16341  Bcl-2-like protein 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04068  FoxO signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04932  Non-alcoholic fatty liver disease
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101084615 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    101084615 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101084615 (BCL2L11)
   04215 Apoptosis - multiple species
    101084615 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084615 (BCL2L11)
   05206 MicroRNAs in cancer
    101084615 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101084615 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101084615 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101084615 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101084615 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact PMAIP1 G_path_suppress
Other DBs
NCBI-GeneID: 101084615
NCBI-ProteinID: XP_003984312
Ensembl: ENSFCAG00000006678
UniProt: A0A2I2UX96
LinkDB
Position
A3:complement(106468660..106517701)
AA seq 140 aa
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQ
PQMIILRLLRYIVRLVWRLQ
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttcagatgtaagttctgagtgtgacagagaaggtggacaattgcag
cctgctgagaggcctcctcagctcaggcctggggcccctacctctctacagacagagcag
caagacaggagcccggcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccattatctcagtgcaatggcttccatgaggcagcctcaggctgta
cccgcagatatgcgcccggagatatggattgcacaagagttgcggcgtatcggagacgaa
tttaatgcatattacccaaggagggtctttttgaataattaccaagcagccgaagcccag
ccccaaatgattatcttacgactgttacgttacatcgtccgcctggtatggcgattgcag
tga

DBGET integrated database retrieval system