KEGG   Felis catus (domestic cat): 101084678
Entry
101084678         CDS       T02385                                 

Symbol
IL13
Name
(RefSeq) interleukin-13 isoform X2
  KO
K05435  interleukin 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04664  Fc epsilon RI signaling pathway
fca05200  Pathways in cancer
fca05310  Asthma
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101084678 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101084678 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101084678 (IL13)
   04657 IL-17 signaling pathway
    101084678 (IL13)
   04664 Fc epsilon RI signaling pathway
    101084678 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084678 (IL13)
  09163 Immune disease
   05310 Asthma
    101084678 (IL13)
   05321 Inflammatory bowel disease
    101084678 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101084678 (IL13)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   101084678 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 101084678
NCBI-ProteinID: XP_003980929
Ensembl: ENSFCAG00000001591
LinkDB
Position
A1
AA seq 183 aa
MWFLDSTRQSGDQGGRRHTWPIKATARGQGHKPLSLGQPTCPLLAPPVLALGSMALWLTV
VIALTCLGGLASPGPHSRRELKELIEELVNITQNQVSLCNGSMVWSVNLTTGMYCAALES
LINVSDCTAIQRTQRMLKALCTQKPSAGQTASERSRDTKIEVIQLVKNLLNHLRRNFRHG
NFK
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtggtttctagatagtacccgacaaagcggagaccagggtgggaggcgtcacacttgg
cctataaaagctaccgcaagaggccaaggccacaagccactcagcttaggccagcctacg
tgtccgctcctcgctcctcctgtgttagctctaggctccatggcgctctggctgaccgtg
gtcattgctctcacctgccttggtggccttgcctccccaggccctcactcaaggagggag
ctcaaggagctcattgaagagctggtcaacatcacccagaatcaggtatccctctgcaat
ggcagcatggtgtggagcgtcaacctgacaaccggcatgtactgtgcagccctagaatct
ctcatcaatgtctctgactgcactgccatccaaaggacccagaggatgctgaaagccctg
tgcactcagaaaccctcagcagggcagactgccagtgagcgcagccgagacaccaaaatt
gaagtgatccagttggtaaaaaacctgctcaaccatctaaggagaaattttcgccatgga
aatttcaaatga

DBGET integrated database retrieval system