KEGG   Felis catus (domestic cat): 101084868
Entry
101084868         CDS       T02385                                 
Symbol
IL18RAP
Name
(RefSeq) interleukin-18 receptor accessory protein isoform X1
  KO
K05174  interleukin 18 receptor accessory protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101084868 (IL18RAP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101084868 (IL18RAP)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101084868 (IL18RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101084868 (IL18RAP)
   04090 CD molecules [BR:fca04090]
    101084868 (IL18RAP)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL1 receptor family
   101084868 (IL18RAP)
CD molecules [BR:fca04090]
 Proteins
  101084868 (IL18RAP)
SSDB
Motif
Pfam: Ig_6 TIR Ig_3 ig Ig_2 I-set TIR_2 Ig_4 Ig_5 V-set
Other DBs
NCBI-GeneID: 101084868
NCBI-ProteinID: XP_003983947
LinkDB
Position
A3:complement(60172937..60206282)
AA seq 586 aa
MTLYLGWIFLWLVTGERTKGLNISDCITKKLLWEYSSGSEKFVLFCDLTESQKSHFHHRS
QLSPTQAPENLPCSGSKDLADVQWYFQPQNGNPLGEITNNYHHIIQDKSILHFSTTGMHN
AGSYICRPRIRSPQGEACCVKTILEVKPKTNVSCVPNNFVSHEQQLLIGSTAYINCPSFH
CQSDAPSSEVTWYKNGKLLSEERSNSILVDEVYDHDQGIYVCDYTDSDNTSSWTVRAVVQ
VTTIVKDTIFKPDILDPIKDTLEVELGKPLTLNCTARFGYQRDFKPVIKWYIKDSDQEWE
VPTPEQKRVKYTKKDDVIERVVHLKEVTQRDLHRKFVCFAQNSIGNTTQSIQLREKKGVV
FIYILLGTVMSLAGVLTTGALLYMYWIEIVLLYRTYQNKDETLGDKKAFDAFVSYAKWSS
FESEATSSLHEEYLALNLFPEVLENKYGYNLCLLERDVAPGGAYAEDIVNVIKKSRRGIF
ILSPNYVNGPSVFELQAAVNLALDDQTLKLILIKFCSFQEPESLPHLVKKALRVLPTVTW
RGLKSVPPNSRFWTQMRYHMPVKNSKGFRWNHLRIMPDFFSLEMTP
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgacgctttatttgggctggatatttctctggcttgtcacaggagagagaactaaagga
ctgaatatttcagattgcatcaccaaaaaacttctttgggaatattcttcagggagtgag
aagtttgtcttattttgtgacttaacagagtcacagaaatcccattttcaccacagaagt
caactctcaccaacccaagcccctgaaaacttgccttgcagtggtagtaaggatctagct
gatgtccagtggtactttcaacctcaaaatggaaatccattaggggaaataactaacaac
tatcatcacatcatccaggacaagagcatcctacacttttcgaccacaggaatgcataat
gctgggtcgtatatctgtagacccaggattcggagccctcagggtgaggcctgttgtgtc
aagaccatcttagaagttaagcctaagaccaatgtatcatgtgtaccaaataacttcgta
tcacacgagcaacaacttcttattggcagcactgcctatattaattgccccagcttccac
tgccaaagtgatgccccaagttcagaggtgacctggtacaagaatggaaaactactctct
gaagaaaggagcaactcaatcctagtggatgaagtttatgaccacgaccagggcatatat
gtatgtgattacactgattcagataacacaagttcatggacagtcagagctgttgtccaa
gtgacaaccatcgtgaaagacactattttcaagccagatattctggaccccatcaaggac
acactggaagtagaacttggaaagcctttaactcttaactgcacggcacgatttggctac
caacgagattttaaacctgtaataaaatggtacattaaagattctgaccaggagtgggaa
gttccaacacctgaacagaaaagagttaaatacaccaaaaaggatgacgttatagagcgt
gttgtccacttgaaagaagtcactcagagggatcttcaccggaagtttgtttgctttgcc
cagaactccatcgggaacacgacccagtccatccagctgagagaaaagaaaggagtggtg
ttcatctacatcctacttggtaccgtcatgagcctggcaggcgtgctgaccacaggtgct
ctgctctacatgtactggattgaaatagtgctgctgtaccgaacctaccagaacaaggat
gagacacttggggataagaaggcatttgatgctttcgtatcctatgcgaaatggagctct
tttgagagtgaggccacttcatctctgcatgaggaatacttggccctgaatctattccct
gaagttctggaaaacaaatatggatacaacttgtgtttgcttgaaagagatgtggcccca
ggaggagcatatgcagaagacatcgtaaacgttattaagaaaagtagaagaggaatattt
atcttgagccccaactatgtcaacggacccagtgtctttgaactacaagcagcagtgaat
cttgccttggatgaccaaacactgaaactaattttaattaagttctgttccttccaagag
ccagagtctctacctcatctggtgaaaaaagctctccgggttttgcccaccgtcacttgg
agaggcttaaaatcggtccctcccaattccaggttctggactcagatgcgctaccacatg
ccggtgaaaaactccaaaggattcaggtggaaccatctcagaattatgcctgattttttt
tcactggaaatgactccgtaa

DBGET integrated database retrieval system