KEGG   Felis catus (domestic cat): 101084961
Entry
101084961         CDS       T02385                                 
Symbol
LTA
Name
(RefSeq) lymphotoxin-alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04064  NF-kappa B signaling pathway
fca04668  TNF signaling pathway
fca04940  Type I diabetes mellitus
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101084961 (LTA)
   04668 TNF signaling pathway
    101084961 (LTA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101084961 (LTA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101084961 (LTA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084961 (LTA)
   05168 Herpes simplex virus 1 infection
    101084961 (LTA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084961 (LTA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101084961 (LTA)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   101084961 (LTA)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 101084961
NCBI-ProteinID: XP_023109516
Ensembl: ENSFCAG00000004498
LinkDB
Position
B2:32578356..32581818
AA seq 205 aa
MTPPGRLYLLRVCSAPLLLLLLGLLLALPPEAQGLPGVGISPSAARTTYQHPQKHFAQGT
LKPAAHLIGDPSTQNSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGC
FPKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQ
LSTHTDGISHLLLSPSSVFFGAFAL
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacaccacctggaaggctctacctcctgcgggtgtgcagcgcccccctcctcctcctc
cttctggggctgctgctggccctgccgcctgaggcccaggggcttcctggtgttggcatc
tcaccctcagctgcccggactacctatcagcaccctcagaagcacttcgcacaaggcacc
ctcaaacctgctgctcatcttattggagaccccagcacccagaactcactgcgctggaga
gcaaacacagatcgtgccttcctccgccatggcttctccttgagcaacaattccctcctg
gtccccaccagtggcctctactttgtctactctcaggtggtcttctctggggaaggctgc
ttccccaaggccaccccgacccctctctacctggcccatgaggtccagctcttctcctcc
cagtaccccttccacgtgcctctcctcagtgctcagaagtccgtgtgcccagggccacag
ggaccttgggtgcgctctgtgtaccagggagctgtgttcctgctcacccagggagatcag
ctatccactcacacagatggcatctcccacctactcctcagccccagtagtgtcttcttt
ggagcgtttgctctgtag

DBGET integrated database retrieval system