KEGG   Felis catus (domestic cat): 101085077
Entry
101085077         CDS       T02385                                 
Symbol
PTCH1
Name
(RefSeq) protein patched homolog 1 isoform X4
  KO
K06225  patched 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04340  Hedgehog signaling pathway
fca04360  Axon guidance
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101085077 (PTCH1)
   04024 cAMP signaling pathway
    101085077 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    101085077 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085077 (PTCH1)
   05205 Proteoglycans in cancer
    101085077 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    101085077 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 101085077
NCBI-ProteinID: XP_011286598
Ensembl: ENSFCAG00000011205
LinkDB
Position
D4:complement(29503355..29574700)
AA seq 1301 aa
MFNPQLMIQTPKEEGANVLTTEALRQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELIT
ETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLQWTNFDPLEFLEELKKI
NYQVDSWEEMLNKAQVGHGYMDRPCLNPADPDCPATAPNKNATKPLDVALVLNGGCHGLS
RKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK
AAAILEAWQRTYVEVVHQSVAPNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLA
YACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVG
VDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALR
AFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYT
ETHDNTRYSPPPPYSSHSFTHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVT
MTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKV
VVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKAD
YPNIQHLLYDLHKSFSSVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPN
NYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKRRLVDADGIINPSAFYIYLTAWVSNDP
VAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAI
EKVRTICNNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLSISVVLACTFLVCAVFLLNPW
TAGIIVTVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDK
NRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLL
PVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFSVPPGHANNGSDSSDSEYSSQTTV
SGISEELRHYEAQQGTRGPAHQVIVEATENPVFARSTVVHPEARHHPPSNPRQHPHLDSE
SLPPGRPGQQPRREPPREGSRPPPYRPRRDAFEISTDGHSGPSNRDRAGPRGARSNNPRH
PAFTAMGSSAPSYCQPITTVTASASVTVAVHPPPAPGPGSGRNPRGGLCPGYGDYSETDH
GLFEDPHVPFNVRCERRDSKVEVIELQDVECEERPRGRSSN
NT seq 3906 nt   +upstreamnt  +downstreamnt
atgtttaatcctcagctcatgattcagaccccgaaagaagaaggtgctaacgtcctgacc
acggaagctctccgacaacacctggactccgccctccaggccagcagagtccatgtgtat
atgtacaacaggcagtggaaattggaacatttgtgctacaaatctggagaacttatcaca
gaaacaggttacatggatcagataatagaatatctttacccttgtttaattattacacct
ttggattgcttctgggaaggggcaaagttacaatctgggacagcgtacctactaggtaag
cctcctttgcagtggacaaactttgaccctttggaattcctagaagagttaaagaaaata
aactatcaagtggacagctgggaggaaatgctgaataaggcccaagttggtcatggttac
atggaccggccctgcctcaacccggctgatccagactgccctgccacagctcccaacaaa
aatgcaaccaaacctcttgatgtggcccttgttttgaacggtggatgtcatggattatcc
agaaagtatatgcactggcaggaggaactgattgtgggtggcacagtcaagaatagcact
gggaagcttgtcagtgcccatgccctgcagaccatgtttcagttaatgactcccaagcaa
atgtatgaacacttcaaggggtacgagtatgtgtcacacatcaactggaacgaggacaag
gcagcagccatcctggaggcttggcagaggacgtacgtggaggtagttcatcaaagtgtc
gccccgaactccacacagaaggtgctttcctttaccacgacgaccctggacgacatcctc
aagtccttctctgatgtcagtgtcatccgagtggccagtggctacttactgatgcttgcc
tatgcctgtttaaccatgctgcgctgggactgctccaagtcccagggtgccgtggggctg
gctggcgtcctgttggttgcactgtcagtggctgcaggattgggcctgtgctcattgatc
gggatttcctttaacgctgcaacaactcaggttttgccatttcttgctcttggtgttggt
gtggatgatgttttccttctggcacatgcatttagtgaaacaggacagaataaaagaatc
ccttttgaggacaggactggggagtgcctcaagcgcacgggagccagcgtggccctcaca
tccatcagcaatgtcactgccttcttcatggccgcattgatcccgattcccgctctgcgg
gcgttctctctacaggcggctgtagtagtggtattcaattttgctatggttctgctaatt
tttcctgcaattctcagcatggatttgtatcgacgggaagacaggagattggatattttc
tgctgttttacaagcccctgcgtcagcagagtgattcaggttgaacctcaggcctacacg
gagactcacgataacacccgctacagccccccgcccccctacagcagccacagcttcacc
cacgaaacccagatcaccatgcagtccacagtacagcttcgcacagagtacgacccccac
acgcatgtgtactataccactgctgaaccacgctctgagatctccgtgcagcccgtcacc
atgacccaggataccctcagttgccagagccccgagagcaccagctccacgagggatctg
ctttcccagttctcggactccagccttcactgccttgagcccccctgcaccaagtggaca
ctttcatcttttgccgagaaacactatgctccttttctcttgaaaccaaaagccaaggtc
gtggtgatcttccttttcctgggcttgctgggggtcagcctttatgggaccacccgagtg
cgtgatgggctggaccttacagacattgtgcctcgggaaaccagagaatatgactttatt
gctgcacagttcaaatacttttctttctacaacatgtatatagtcacccagaaagcagac
tacccaaatatccagcacttactctacgaccttcacaagagtttcagcagcgtgaagtat
gtcatgttggaagaaaataaacagcttcccaaaatgtggctgcactacttcagagactgg
cttcaaggacttcaggatgcatttgacagtgactgggaaactgggaaaatcatgccaaac
aattacaaaaatggatccgatgatggagtccttgcctacaaactcctggtgcaaaccggc
agccgtgataaacccatcgacatcagtcagttgaccaaacggcgcctggtggatgcagac
ggcatcatcaaccccagtgctttctacatctatctgaccgcctgggtcagcaatgacccc
gtggcttatgccgcctcccaagccaacatccggcctcaccgtcctgagtgggtgcacgac
aaagctgactacatgccggaaaccaggctcagaatcccagcagcggagcccattgaatac
gctcagttccctttctacctcaacggcttgcgggacacctcagacttcgtggaagcaatc
gaaaaggtcagaaccatctgcaacaactacacgagcctggggctctccagctaccccaac
ggctaccccttcctcttctgggagcagtacatcggcctccgccactggctcctgctatcc
atcagcgtggtgctggcctgcacgttcctcgtgtgcgccgtcttcctcctgaacccctgg
acggccgggatcattgtgacggtcctggctttgatgacggtcgaactctttggaatgatg
ggcctcattggaatcaagctgagtgctgtgcctgtggtcatcctgatcgcttccgtgggc
atcggagtggagttcaccgttcacgttgctctggccttcctaacagccattggtgataag
aaccgcagggccgtgcttgccctggagcacatgtttgcacctgtcctggacggcgctgtc
tccactctgctgggagtactcatgctggcaggatctgagtttgatttcattgtcaggtat
ttctttgctgtcctggcaatcctaacaatcctgggtgttctcaatggactggttttgctt
ccagtcctgctgtccttctttggaccgtatcctgaggtgtctccagccaatgggctgaac
cgactgcccaccccttcccctgagccgccccccagcgtggtccggttttccgtgccccct
ggtcatgcaaacaatgggtccgattcctctgactcagagtacagttctcagacgacagtg
tcgggcatcagcgaagagcttcggcactacgaggcccagcagggcaccaggggccctgcc
caccaagtgatcgtggaagccacagaaaaccccgtgtttgcccgctctacagtggtccat
cccgaagcgagacatcacccaccctcaaaccctcgacagcatccccacctggactcagag
tccctgcctccaggacggccgggccagcagccccggagagaaccccccagagaaggctca
cggccacccccctacagaccgcgcagagacgcttttgaaatttctactgacgggcattct
ggccctagcaatagggaccgtgcgggcccccggggagcccgttctaacaaccctcggcac
ccagcattcactgccatgggcagctctgcgcccagctactgccagcccatcaccactgtg
acggcctcggcgtccgtgactgttgccgtgcacccgccacctgcccccgggcccgggtcc
ggtcggaacccccgagggggtctctgcccgggctacggggactactctgagactgaccac
gggctgtttgaggacccccacgtgccttttaacgtccggtgcgagaggagggattccaag
gtggaagtcatagagctgcaggacgtggaatgtgaggagaggccccggggcaggagctcc
aactga

DBGET integrated database retrieval system