KEGG   Felis catus (domestic cat): 101085214
Entry
101085214         CDS       T02385                                 
Symbol
NEDD4
Name
(RefSeq) E3 ubiquitin-protein ligase NEDD4 isoform X2
  KO
K10591  E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04530  Tight junction
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101085214 (NEDD4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101085214 (NEDD4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101085214 (NEDD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101085214 (NEDD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085214 (NEDD4)
   04121 Ubiquitin system [BR:fca04121]
    101085214 (NEDD4)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101085214 (NEDD4)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     101085214 (NEDD4)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101085214 (NEDD4)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  HECT type E3
   101085214 (NEDD4)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    101085214 (NEDD4)
SSDB
Motif
Pfam: HECT WW C2 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 101085214
NCBI-ProteinID: XP_004001689
LinkDB
Position
B3:50741720..50880778
AA seq 900 aa
MATCAVEVFGLPEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGIFTSVQ
TKTIKKTLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEEDNTEQTEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDSLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMDSNRAFPSPPASNNLDVQTHLAEE
LNARLTMCRNSATGQPVSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTAQAAVETGQLQPGQGATRPQPQVLPSDSAQQVTQPAEMEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDSSNDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFVIDEELFGQTHQHELKIGGS
EIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGL
GDVDVNDWREHTKYKNGYSVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
NT seq 2703 nt   +upstreamnt  +downstreamnt
atggcaacttgcgcggtggaggtgttcgggctcccggaggatgaggaaaattcccgaatt
gtgagggtcaaagtgatagctggaataggccttgccaaaaaggatatcttgggagctagt
gatccatatgtgagagtgacattatatgacccaatgaatggaatttttacaagtgtgcaa
acgaaaaccattaaaaagactttgaatccaaaatggaatgaagaaatactattcagagtc
catcctcagcagcaccggcttctatttgaagtatttgatgaaaatcgattgacaagagat
gatttcctaggtcaagtggatgttcctctttatccattaccgacagaaaatccaagaatg
gagagaccatatacgtttaaggattttgttcttcacccaagaagtcacaaatcaagagtt
aaaggttatctgagattaaaaatgacttatttacctaaaaccagtggctcagaagaagat
aatacagaacagactgaagaattagagcctggctgggttgttttggaccaaccggatgct
gcttgccatttgcagcaacaacaagaaccttctcctctacctccaggatgggaagagagg
caggatattcttggaaggacctactatgtaaaccatgaatctagaagaacacagtggaaa
agaccaacccctcaggacagcctaacggatgctgagaatggtaatattcaactgcaggca
caacgtgcatttaccacaaggcggcaaatatctgaggagacagaaagtgttgataatcga
gagtcttccgagaactgggaaattataagagaagatgaagccaccatggatagcaatcgg
gccttcccatcacctccggcatcaaataacttggatgttcaaactcatcttgcagaagaa
ttgaatgccagactcactatgtgtagaaattcagccaccggacagccagtatccagctca
aatcattccagcagaagaggcagcttacaagcctatacttttgaggagcagcctacactt
cctgtgcttttgcctacttcatctggattaccaccaggttgggaagaaaaacaagatgaa
agaggaagatcatattacgtagatcacaattccagaactactacctggacaaagcccact
gcacaggccgccgtggagacaggtcagctgcagcccggccagggtgccacacgccctcaa
ccacaggtcctcccgagtgattcagcacagcaggtgacccagccagctgaaatggagcaa
ggattccttcctaaaggctgggaagtccggcatgcaccaaatgggaggcctttctttatc
gaccacaacacgaaaaccactacctgggaagatccaagactgaaaattccagctcatctg
agaggaaagacatcacttgattcttccaatgatctggggcctttacctccaggatgggaa
gaaagaactcatacagatggaagaatcttctatataaatcacaatataaaaagaacacaa
tgggaagatccccggttgcagaatgtagcaataactggaccagcagtgccctactccagg
gattacaaaagaaagtatgagttcttccgaagaaagttgaagaagcagaatgacattcca
aacaaatttgaaatgaaacttcgccgtgcaactgtccttgaggactcttaccggagaatt
atgggtgtcaagagagcagattttctcaaggctagactgtggattgaattcgatggtgaa
aagggattagattatggaggagtggccagagaatggttcttcttgatctcaaaggaaatg
tttaacccttattatgggttgtttgaatattctgctacggataattataccctgcagata
aatccaaactctggattgtgtaatgaggatcacctctcttacttcaagtttattggccgg
gtagcgggaatggcagtttatcatggcaaactgttggatggttttttcatccgcccattt
tacaagatgatgctacacaaaccaataacacttcatgatatggaatcagtggatagtgaa
tattacaattcactaagatggattcttgaaaatgatccaacagaactggacctcaggttt
gtcatagatgaagaactttttggacagacacatcaacatgagttgaaaattggtggatca
gaaatcgttgtcaccaacaagaacaaaaaggaatatatttatcttgtaatacagtggcga
tttgtaaaccgaatccagaagcaaatggctgcttttaaagagggattttttgaactaata
ccacaggatctcatcaaaattttcgatgaaaacgaactagagcttcttatgtgtggattg
ggagatgtcgatgtgaatgactggagagaacacacaaagtataaaaatggctacagtgtg
aaccatcaagtgatacagtggttttggaaggctgttctaatgatggactcagagaaaaga
atccgattactccagtttgtcactggcacatctcgtgtgcctatgaacgggtttgcggaa
ctatatggctcaaatggaccacagtcatttacagttgaacagtggggtacccctgaaaag
ctgccaagagcccatacatgctttaatcgcttggacttgccaccctatgaatcatttgaa
gaattatgggataaacttcagatggcaattgagaacactcagggttttgatggtgttgat
tag

DBGET integrated database retrieval system