KEGG   Felis catus (domestic cat): 101085410
Entry
101085410         CDS       T02385                                 
Symbol
DSG1
Name
(RefSeq) desmoglein-1
  KO
K07596  desmoglein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101085410 (DSG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fca04515]
    101085410 (DSG1)
Cell adhesion molecules [BR:fca04515]
 Cadherins
  Major cadherins
   101085410 (DSG1)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3
Other DBs
NCBI-GeneID: 101085410
NCBI-ProteinID: XP_011286361
LinkDB
Position
D3:55242129..55283376
AA seq 1074 aa
MDWHFVRTAAVLFILLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVT
PFFIIYCRALNSLGQDLERPLELRVRVLDINDNPPVFSMSTFLGQIEENSNANTLVMRLN
ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYSQYSLAVRGS
DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYSASIEENALHSNLAQIRVIDLDEEYS
ANWIAVIFFISGNEGGWFDIEMNERTNVGILKVVKPLDYEDMKNLQLSIGVRNKAEFHHS
VMSQYKLTATAISVTVLNVIEGAVFRPGSKTYVVTSNMGQNYKVGDFIATDLDTGVASTT
VRYVMGNNPANLLDIDSRTGIITLRNAVTMEQYKMLGGKYQGTILSIDDTLQRTCTGTIN
INLDGSGWKEDKSNQGTTTEDSGNDGGGSATGGATGGDTGGDTGGDTGGDTSTNTADKTS
TDYGGGTNTDSNTYDQTGGGYQRNPLDNVHFGPAGIGLLIMGFLVLGLVPFLLICCDCGG
APRGGAGFEPVPECSDGAIHSWAVEGPQPPPISGPTVCVPPVLPSNGNLIECIDTSGVYT
NEYGGREMQDLGGGERTTGFELTEGVKTPGVPEICQEYSGTLRRNSMRECREGGLNMNFM
ESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDVDDSFLDTLGPK
FKKLADISLGKEAETYPDPDPSWPPESTEPICPQQGTEPVIGGHPPISPHFGTTTVISES
TYPSGPGVQHPMPIPDPLGYGNVTVTESYTTSGTLKPSVHVHDNRHAANVVVTERVVGPI
SGTDLHGMLEMPDLRDGSNVIVTERVIAPSSSLPTSLTMPDPRESSNVVVTERVIRPVSG
MMGNLSIHPELSNAQNVIVTERVVSGSGISGISGPAGISGGSGLVGSAAGVSGSGIGQSS
LGGGGGLGSSMGGTATIGHMRSSSDHHFSQTLGSASPSTARSRITKYSTVQYTK
NT seq 3225 nt   +upstreamnt  +downstreamnt
atggactggcactttgttagaacagctgcagtgctgttcattcttctggtggtggtggaa
gttaacagtgaatttcgaatccaggtaagagattacaacaccaaaaatggcaccatcaag
tggcattcaatcaggaggcaaaaacgtgaatggatcaagttcgctgcagcctgtcgtgaa
ggtgaagacaattcaaagaggaacccaattgccaaaattcactcagattgtgctgcaaac
cagcaagttacataccgcatctctggagtaggaattgatcagccaccttatggaatcttc
attattaatcaaaaaactggtgaaattaatataacatccatagttgatcgagaggtcacc
ccttttttcattatctattgccgggctctgaattccttgggtcaagatttagagaggcct
ctcgagctcagagtcagggttttggatataaatgacaaccctccagtattttctatgtct
acttttctgggacaaatagaagaaaattctaatgcaaatacactggtgatgagactcaat
gctactgatgcagatgaaccaaataatttgaactcaaaaatagccttcaagatcataaga
caggaaccttctgattcaccaatgtttattatcaacagaaacactggagaaattcgaaca
atgaataattttctagacagagagcaatacagccagtattcccttgctgtgagaggctca
gaccgagacggtggggcagatggcatgtcagcagagtgtgaatgcaacattaaaatcctt
gacgttaatgataacatcccgtacatggaacagtcttcatattctgctagtattgaagaa
aatgctctacattcaaatttggcccagattagagtaattgacttggacgaagagtactca
gctaactggatagcagtcattttctttatctctggaaatgaaggaggttggtttgacata
gaaatgaatgaaagaacaaatgtgggaattttaaaggttgttaagcccctagattatgaa
gatatgaagaatctgcaacttagtattggtgtcagaaataaagctgaatttcatcattca
gttatgtctcaatacaaactcacagcaaccgccatctctgtgactgtgttaaatgtaatt
gaaggcgcagtgttccgtccaggttcaaagacatatgtagtgactagcaacatgggacaa
aattataaagtgggagactttatagctactgaccttgacacaggtgtagcttcaacaact
gttagatatgtaatgggaaataatcctgctaacctacttgatattgactcaagaacaggc
ataattactttgagaaatgcagttaccatggaacaatataaaatgcttggggggaaatac
caaggaacaattctatctatagatgatactcttcaaagaacttgtactggaacaattaat
attaacctcgatggttccggctggaaagaggataaaagtaatcagggaaccactactgaa
gacagtggaaatgacggcggtggaagtgccactggaggtgccaccggaggtgacaccgga
ggtgacaccggaggtgacaccggaggtgacaccagtactaacacagccgacaaaacttcc
actgattacggcggtggtaccaatacagacagcaacacctatgaccaaacaggtggtggt
taccagagaaatcccttagataatgtccattttggtcctgctggcattggactactcatc
atgggattcttggtcctaggattggtcccgtttttgttgatctgttgtgactgcggtggc
gcccctcgtgggggcgctggctttgagcctgtccccgaatgttcagatggagcaattcac
tcatgggcagtagaaggaccacaaccgcctcccataagtggacccactgtctgtgtacca
ccggtactacctagtaatggaaatttgattgaatgcattgacacctcaggggtttacaca
aatgagtatggcggcagagaaatgcaagatctaggaggaggagaaagaacaacaggattt
gaactaacagaaggagttaaaacaccaggagtacctgagatatgtcaagaatattctgga
acattaagaagaaattctatgagagaatgtagagaaggaggtctgaatatgaacttcatg
gaaagttacttctgtcagaaagcatatgcttatgcagatgaagatgaaggacgcccatcc
aatgactgtttgctcatatatgatattgaaggtgtaggttcccctgctggctccgtgggc
tgctgtagcttcattggagaagacgtggacgatagctttttggacacactggggcctaaa
tttaagaagctggcagatatcagcctgggaaaagaagctgaaacatatccagaccctgat
ccgtcttggccacctgagagcaccgaaccgatctgccctcagcagggaacagagcccgtc
attggtggacacccacccatctccccacatttcggcactacaactgtcatctctgagagc
acctacccctcaggacctggtgtacagcatcctatgcctattcctgatcctctgggctat
ggtaatgtcactgtgacagaatcttacaccacctctggcactctgaagccctctgtccat
gttcatgataaccgacatgcagcaaacgtagtagtgaccgagagggtggttggcccaatc
tctggcactgatctgcatggaatgttagagatgcctgacttgagagatgggtcaaatgtt
atagtgacagaaagggtaatagcaccaagttcaagtctacccacctctttgaccatgcct
gatcctagagagtcatcaaatgtggtagtgacagaaagagtcatccgaccggtttctggc
atgatgggcaatctaagtatacaccctgagttatcaaatgcccaaaatgtgattgtgaca
gagagggttgtttccggctctggcataagcggaatcagtggccccgctgggataagtgga
ggcagtggcctggttggcagtgcagctggagtaagtggcagtggcattgggcagagcagc
ctgggaggaggtgggggcctgggtagcagcatgggggggacagccaccattggccacatg
aggagctcctctgaccatcactttagccagacccttggatctgcctcccctagtacagcc
cgaagtcgaatcacaaaatacagtacagtacaatatacgaagtag

DBGET integrated database retrieval system