KEGG   Felis catus (domestic cat): 101085520
Entry
101085520         CDS       T02385                                 
Symbol
SELE
Name
(RefSeq) E-selectin
  KO
K06494  selectin, endothelial cell
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04668  TNF signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05143  African trypanosomiasis
fca05144  Malaria
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101085520 (SELE)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101085520 (SELE)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101085520 (SELE)
   05143 African trypanosomiasis
    101085520 (SELE)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101085520 (SELE)
   05418 Fluid shear stress and atherosclerosis
    101085520 (SELE)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101085520 (SELE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fca04515]
    101085520 (SELE)
   04090 CD molecules [BR:fca04090]
    101085520 (SELE)
   04091 Lectins [BR:fca04091]
    101085520 (SELE)
Cell adhesion molecules [BR:fca04515]
 Selectins
  Selectin family
   101085520 (SELE)
CD molecules [BR:fca04090]
 Proteins
  101085520 (SELE)
Lectins [BR:fca04091]
 C-Type lectins
  Group 4: Selectins
   101085520 (SELE)
SSDB
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_3 EGF_2
Other DBs
NCBI-GeneID: 101085520
NCBI-ProteinID: XP_011289204
UniProt: A0A2I2TZY2
LinkDB
Position
F1:complement(14286748..14295363)
AA seq 556 aa
MTRTLEVMTASRLLPALTLVLLLLKGSRAWSYNASTEIMTFDEASEYCQQRYTHLVAIQN
QEEIQYLNSILSYSPTYYWIGIRKVNNTWTWIGTQKPLTEEAKNWAPGEPNNKQSNEDCV
EIYIKRDKDAGKWNDERCSKKKLALCYTAACTPTSCSGHGECVETVNNYTCECYPGFKGL
RCEQAVTCQAREAPEHGSLVCTHPLGTFSYNSFCSVSCEKGYLPSSTEATRCTSTGEWSA
PVPACNVVECDALTNPANGVMDCSQSSGNFPWNTTCAFECEAGFELMGSQRLQCTSSGKW
DDEKPTCKAFQCKALSRPERGYVSCLPAASGSFQKGSSCEFFCEQGFVLKGSKKLQCGPT
GEWDSEEPTCEAVKCDAVRQPQRGSVTCTHSPAGEFTYKSSCAFSCEEGFKLRGSAQVEC
TSQGQWTQEVPSCQAVRCSGLAALGKMNVSCDGEPAFGAVCAFACPEGWTLNGSAALTCD
ATGHWSGTPPTCEAPTESGIPLAVGLTAAGTSLMTVASFVLWLLKRLRKRAKKFVPASSC
QSLQSDGSYQMPSESL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgacaagaaccctggaagtcatgactgcttcacgacttctccctgctctcactcttgtg
cttctcctgcttaaagggagcagagcctggtcttacaacgcctccacagaaatcatgact
ttcgacgaagctagtgagtattgccagcaacggtacacgcatctggtcgcgattcaaaac
caggaagagattcagtacctgaactccatcttgagctactcgccaacttactactggatc
ggaatcagaaaggtcaacaatacgtggacctggatagggacccagaagcctctgaccgaa
gaagccaagaactgggctcctggtgaaccgaacaataagcaaagcaatgaggactgcgtg
gagatctacatcaagagagacaaggacgcgggcaagtggaatgacgagagatgtagcaaa
aagaagcttgccttgtgctacacagctgcctgtacccccacatcctgcagtggccacggc
gagtgtgtggagactgtcaacaactacacgtgcgagtgctaccccggcttcaagggactc
aggtgcgagcaagcggtgacctgtcaagcgcgggaagcccccgagcacggaagcctggtt
tgcacccaccctctggggaccttcagctacaattctttttgctctgtcagctgcgaaaag
ggctacctcccaagcagcacagaggccacacggtgcacgtccacgggagaatggagcgcc
cccgttcctgcctgcaatgtggtcgagtgcgatgctctgacaaatcctgccaacggagtc
atggactgttcccaaagctctggaaacttcccatggaacacgacttgtgcctttgagtgt
gaagcaggatttgaactaatgggatcccagcgcctccagtgtacctcatccgggaaatgg
gatgacgagaagccaacgtgtaaagcttttcagtgcaaagccttgtcccgcccagagaga
ggctacgtgagttgtcttcctgctgcttctggaagtttccaaaaggggtccagctgtgag
ttcttctgcgaacagggatttgtcttgaagggatccaaaaagctccagtgtggccctaca
ggcgaatgggacagtgaggagcccacgtgtgaagctgtgaagtgtgatgccgtccggcag
ccccagcgtggctctgtgacatgtacccattcccccgctggagagttcacctacaagtcc
tcctgtgccttcagctgtgaggaaggcttcaaattgcgtgggtcagctcaagtcgagtgc
acatctcagggccagtggacgcaggaagtcccctcctgccaagccgtacgatgttcggga
ctggcagcgttgggaaaaatgaacgtgagctgcgacggggagccagcgtttggcgctgtg
tgtgcgtttgcgtgtcctgagggctggaccctcaacggctccgcagctctgacgtgcgat
gccacgggacactggtccgggacgccgcctacctgcgaagctcccactgagtccggcatt
cccttggctgttggactcaccgccgctgggacctccctcatgacggtagcatcatttgtc
ctctggcttctgaaacgcctgcggaagagagcaaagaaatttgttcctgccagcagctgc
caaagcctccaatcagatggatcctaccagatgccttctgagtccctttaa

DBGET integrated database retrieval system