KEGG   Felis catus (domestic cat): 101085657
Entry
101085657         CDS       T02385                                 
Symbol
ARHGEF12
Name
(RefSeq) rho guanine nucleotide exchange factor 12 isoform X1
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca04270  Vascular smooth muscle contraction
fca04360  Axon guidance
fca04611  Platelet activation
fca04625  C-type lectin receptor signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101085657 (ARHGEF12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101085657 (ARHGEF12)
   04625 C-type lectin receptor signaling pathway
    101085657 (ARHGEF12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101085657 (ARHGEF12)
  09158 Development and regeneration
   04360 Axon guidance
    101085657 (ARHGEF12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085657 (ARHGEF12)
   05205 Proteoglycans in cancer
    101085657 (ARHGEF12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101085657 (ARHGEF12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101085657 (ARHGEF12)
   05152 Tuberculosis
    101085657 (ARHGEF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085657 (ARHGEF12)
Membrane trafficking [BR:fca04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101085657 (ARHGEF12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 Peptidase_M50 COS Ribonuc_2-5A
Other DBs
NCBI-GeneID: 101085657
NCBI-ProteinID: XP_006936792
Ensembl: ENSFCAG00000026560
UniProt: M3X136
LinkDB
Position
D1:17655804..17807748
AA seq 1543 aa
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVESSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTSSRSLGDPPTVSEVEADPGDGLGRIDYSSGDAS
RPSSDSAESPKSALKERIYLEENPEKSEVIQDTDTQSLIGSPSPRMAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVSVPDEISIDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRVTLEKERACAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKQRHPKHLSTPSSVSPEPQDSAKLRQSGLAGEGTDVGY
LPANSMSSGASGATLSQEGGKENDLGSKQVGETPASGDCMDGAPRTPNTIFDFPPPPLDQ
VQEEEWEVERVPEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPMEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSAK
PIPLPQSPPCEGDNDEEEPPKLKVEHHSISVPGLQSPDRDLGLESPLISSKPQSHSLGAS
GKSEVDDLFVAERQFAKERHADGTLQEAGASYQIPIPDPHLPASEERWALDALRNLGLLK
QLLVQQLGLAEKSTQEDWSRFLRYGTASSGVQTDSVTQNSENSKACPPGEGQVSFRTESG
DISTCYSPRTSTESSAPRDSVVLAFQDSQASNILVMDHMIMTPEMPPAEPEGSLDESGEH
FFDAREAHSDDNPSEGDGVVKKEEDVNLRISGNYLILDGYDAVQESSTDEEVASSLPPPP
TTGAPPTDSAGQQQHSPQNAHSDGALSPFTPEFLVQQRWGAMEDSCFEIQSPPSCADSQS
QIMEYIRKIEADLEHLKKVEESYNILCQRLAGSALTDKHSDKS
NT seq 4632 nt   +upstreamnt  +downstreamnt
atgagcggcacacagtccactatcaccgacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaagcagaaagttgagcgcagtgca
tcacatgattttgatcccacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatatatggtcttgttcagcgttgtgtgatcatccagaaggatgacaat
ggatttgggctgacggtcagtggagacaatccagtcttcgtacagtctgtcaaagaagat
ggagcagccatgcgggctggagtacagacaggtgatcgaatcatcaaggtgaatggtaca
ttggtgactcattcaaaccatttggaagtggtgaagctaatcaaatctggttcctatgta
gctctcactgttcagggacgcccacctgggtcgccccagattccacttgccgattctgaa
gtagagtcatcagtcattggacatatgtctcccatcatgacatcccctcattcacctgga
gcatctgggaacatggagagaattactagtcctgtgctcatgggggaggaaaacaatgtg
gttcataaccagaaagtagaaattctgagaaaaatgttacagaaagaacaagaacggctg
cagttattgcaggaagattacaaccgaacacctgcccaaagattgctaaaagagatccaa
gaggccaagaaacacattcctcagctgcaagagcagttatccaaagccacaggctctgct
caggatggagctgtagttacgtcctccaggtctttaggtgaccccccgacagtcagtgag
gtagaagcagaccctggtgacggactagggagaattgactacagcagcggagatgcttct
cggcccagtagtgacagcgcggaaagtcccaagagtgccctgaaagagaggatttatcta
gaggaaaacccagagaaaagcgaagtgattcaggacactgacactcagtcactcatcggg
agcccctctccccgaatggcacctcatattattggagcagaggatgatgattttggtact
gaacatgaacagatcaatgggcagtgcagctgtttccagagcattgaactgctaaaatct
cgccctgctcacctggctgttttcttacaccacgtagtttcacagtttgaccctgcaacg
ttgctctgttatctctattcagacctatataagcagaccaattccaaggagactcggcgt
gtcttcctcgagtttcatcagtttttcctggatcgatctgcacacctgaaagtttctgtt
cctgatgaaatatcaatagatctagaaaaaagaagacctgagcttatacctgaggatcta
caccgccactatattcaaactatgcaggaaagagtccacccagaagttcagaggcacttg
gaagattttcggcagaaacgtagcatggggctgaccttggctgaaagcgagctgacaaaa
ctcgatgcagagcgagacaaggaccgggtaactttggagaaggaacgggcatgtgcggaa
cagattgttgccaaaatcgaagaagtgttgatgactgctcaggctgtagaagaagataaa
agttcaacaatgcagtatgttatccttatgtacatgaagcatttgggagtaaaagtgaaa
gaacctcgaaatttggagcacaagcgaggtcggattggattccttccaaaaatcaagcaa
agtatgaagaaagatcgagaaggcgaagaaaaagggaagcgcagaggattccccagcatc
ctgggacccccaaggagaccaagccgtcatgacaacagtgcaattggcagagctatggaa
ctacagaagcagcggcaccctaagcacttatccacaccctcttctgtgagtcctgagcct
caggactctgccaagttgcgccagagtgggttagcaggtgaaggaacagacgttgggtac
ctgccagccaattccatgtcctctggggcttcaggggccactctttcccaggaaggaggg
aaagagaatgatctgggatcaaagcaagttggagaaacacctgcatccggagactgcatg
gatggcgcccctcgcactcccaataccatcttcgatttcccacctcctccgttagaccaa
gtgcaggaggaagagtgggaggtggaaagggtgcctgaacatgggacaccaaagcccttt
cgaaaattcgacagcatagcttttggagaaagtcaaagtgaggatgaacagtttgaaaat
gacttagagacagatccacccaactggcaacagctcgttagtcgagaagtgttactggga
ctaaagccttgtgagatcaaaagacaggaagtaattaatgaattgttctacactgaaaga
gctcatgttcgaacactgaaggttcttgatcaagtgttctaccagcgagtatccagagaa
ggaattctgtcaccttcagaactacggaaaattttttcaaacttggaagatattcttcaa
cttcacattggattgaatgagcaaatgaaggcagttcgcaagaggaatgagacctcagtt
attgatcagattggggaagatttactgacctggttcagcggaccaggggaggagaagttg
aaacacgctgctgccaccttttgcagtaaccaaccttttgccctggaaatgatcaagtct
cgtcagaaaaaggattcccgatttcagacttttgtgcaagatgccgagagcaatccgctg
tgtcgtcgtctgcagctgaaggatatcattcctacccaaatgcagaggcttactaagtac
cctcttctgttagataatattgccaaatacacagaatggccaatggaaagggagaaggtg
aagaaagctgcagatcactgtcgtcagatcttaaactatgtaaatcaggctgtcaaggag
gcagaaaataagcagcgcttagaagactatcagcgtcgcctcgatacctccaatctgaag
ttgtcagagtacccaaatgtggaagagctcaggaatttggatttaacaaaaaggaagatg
attcatgaagggccactggtctggaaggtgaatcgggataaaactatcgatctgtacacg
ttgctgctggaagacattctggtattgttacaaaaacaggatgacagactggtgttacga
tgtcatagtaagattctggcatctacagctgatagcaaacacacgtttagccctgtcatt
aagttgaatacagtgttggttcgacaagtggcaacagataacaaagctttgtttgtcatc
tccatgtcggacaatggggcccaaatttatgaactggtggcacagacagtttctgaaaag
actgtctggcaggaccttatctgccggatggccgcatcagtgaaggaacagtcggcgaag
ccaatcccactgccccagtcaccaccttgcgaaggagacaacgatgaagaagaacctcca
aaattaaaagtggagcatcatagcatttcagtccctggtctgcagagtccagacagagat
ttgggattagagtctcccttaatatcgtcaaaacctcagtctcattcactgggtgcctct
gggaagtccgaggtagatgatctgtttgtggctgagagacagtttgctaaggagcggcat
gcagatgggactctgcaggaagctggagcaagttaccaaattccaatcccagacccgcac
ttgcctgcctcagaagaacggtgggccttggacgcactaaggaatttgggcttgttgaag
cagttgcttgtacaacagctgggtttggctgagaagagcactcaggaagactggtcacgt
ttcctgagatacggaacagcgtcttccggggtgcagacagacagtgtaacccagaactct
gaaaatagtaaggcctgtcctcctggtgaaggacaggtgtcctttagaactgaaagtggt
gacatttccacttgttacagtccacggacttcaactgaatcttctgctccacgagattca
gtggtactggcattccaagatagccaggcaagtaacattttagtaatggaccacatgatt
atgaccccagagatgcctcctgcagagccagaagggagtcttgatgagagtggagagcac
ttttttgatgcccgggaagcacatagtgatgataatccatcagaaggtgatggagtggtt
aagaaggaagaggatgttaatttgcgcatctcaggaaactatttgatccttgacggctac
gatgcggtgcaggagagctccacggatgaggaggttgcttcctcactccccccaccgccc
acgacaggcgccccccccacggactctgccggccagcagcagcattctccccagaacgcc
cattccgatggggcgctctcaccgttcaccccggaattcctggtccagcagcgctgggga
gctatggaggattcctgttttgagatccagagtcccccctcttgtgcagactcacaaagc
cagatcatggagtacattcgtaagatcgaggctgaccttgaacacttaaagaaggtggag
gaaagttacaacattctttgccaaaggctggctggatcagccctcacagacaagcactca
gataaaagttag

DBGET integrated database retrieval system