KEGG   Felis catus (domestic cat): 101085689
Entry
101085689         CDS       T02385                                 
Symbol
IL6R
Name
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04066  HIF-1 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04659  Th17 cell differentiation
fca04932  Non-alcoholic fatty liver disease
fca05163  Human cytomegalovirus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101085689 (IL6R)
   04066 HIF-1 signaling pathway
    101085689 (IL6R)
   04151 PI3K-Akt signaling pathway
    101085689 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101085689 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101085689 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101085689 (IL6R)
   04659 Th17 cell differentiation
    101085689 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085689 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101085689 (IL6R)
   05163 Human cytomegalovirus infection
    101085689 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101085689 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101085689 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101085689 (IL6R)
   04090 CD molecules [BR:fca04090]
    101085689 (IL6R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101085689 (IL6R)
CD molecules [BR:fca04090]
 Proteins
  101085689 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 V-set I-set Ig_5
Other DBs
NCBI-GeneID: 101085689
NCBI-ProteinID: XP_023103841
Ensembl: ENSFCAG00000026747
LinkDB
Position
F1:complement(70919010..70964695)
AA seq 468 aa
MLALRCALLTALLAAPGAALTPGGCPAPEVLSDVVTARPGANVTLTCPGEEPGDSATIHW
LLRNRVPGSQQERGAGVGGRLLLRSVQLSDSGNYSCYRDDGSLAGTVPLLVEAPPEEPQI
TCFRKSPLSKVACEWGPRSPPSGTTRATLLVRKFGTSPMGDSEEPCQYFPGPQTFSCQLA
VPEGDNSLYVVSLCVSNAAGSKSSHPQTFEGYGILQPDPPVNVTVTAVPGNPRWLRVTWR
DPPSWNSYFYRLQFELRYRAERSKTFTTWMVKELQHHCIIHDAWRGTRHRVQVRAREEFG
HGSWSAWSPEAAGAPWTEPRSPPAKTEAPPSTQAPTTNGDDENNLLKDSANATSLPVQDS
SVPLPTFLVAGGSLAFGTLLCVGLVLRFRKTWKLQALKEGKASAQPPYALGQLVPERPQP
RPGLVPLLSPPVNPGSLGSDNTSGHGRPDARGPRSAYDVTNRDYFLPR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgctggccctgcgctgcgcgctgctcaccgccctgctggccgcgccaggggccgccctg
acccccgggggctgtcccgcgccggaggtgctgagtgatgtggtgactgcccggcctggg
gccaacgtgaccctgacctgcccgggcgaggagcctggagacagtgccacgattcactgg
ctgctgaggaatcgggtcccaggctcacagcaggaacggggtgctggcgtgggagggagg
cttcttctgaggtcggtgcagctcagcgactctggaaactactcctgttaccgcgacgac
ggcagcctggctggaaccgtgcctttgctggtggaagcccctcccgaggagccccagatc
acctgcttccggaagagccccctcagcaaggtggcctgtgagtggggtcctcggagcccc
ccctccgggacgaccagggccacgcttctggtgaggaagttcgggaccagccccatggga
gactcggaggagccgtgccagtactttccggggccgcagaccttctcctgccagctggca
gtccctgagggggacaactccttgtacgtggtgtccctgtgcgtcagcaacgccgctggg
agcaagtccagccatccccaaacgtttgagggctacggaatcctgcagcctgacccgcct
gtcaatgtcaccgtcactgctgtgcccggaaacccccgctggctcagggtcacctggcgg
gaccccccgtcctggaactcctacttctacaggctgcagtttgagctccgataccgggcc
gagcggtcgaagacgttcacaacgtggatggtcaaggagctgcagcatcactgcatcatc
cacgacgcctggagaggcacgaggcacagggtgcaggtccgggcccgggaggagtttggg
cacggctcctggagcgcgtggagcccggaggccgcgggcgccccgtggacagaacccagg
agccccccagccaagacggaggcgcccccctccacgcaggcaccgactactaatggagac
gatgaaaataatctcttgaaagattctgcaaatgcaaccagcctcccagtgcaagactct
tcggtgccactgcccaccttcctagtggccggaggaagcctggccttcggaacgctcctg
tgcgttggcctcgtcctgaggttcaggaagacgtggaagctgcaggccctgaaggaaggc
aaggccagcgcacagccgccgtatgctctggggcagctggtccccgagaggccccagccc
aggccggggctcgtccccctcctctctcctcccgtgaaccccggcagcctcgggtctgac
aacacgtcggggcacggccggccggacgccaggggcccccggagcgcttacgacgtcact
aaccgagactacttcttacccagatag

DBGET integrated database retrieval system