KEGG   Felis catus (domestic cat): 101085762
Entry
101085762         CDS       T02385                                 
Symbol
RELB
Name
(RefSeq) LOW QUALITY PROTEIN: transcription factor RelB
  KO
K09253  transcription factor RelB
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101085762 (RELB)
   04064 NF-kappa B signaling pathway
    101085762 (RELB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101085762 (RELB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101085762 (RELB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085762 (RELB)
   05169 Epstein-Barr virus infection
    101085762 (RELB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101085762 (RELB)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101085762 (RELB)
SSDB
Motif
Pfam: RelB_transactiv RHD_DNA_bind RelB_leu_zip RHD_dimer
Other DBs
NCBI-GeneID: 101085762
NCBI-ProteinID: XP_023101687
LinkDB
Position
E2:complement(11639651..11669619)
AA seq 664 aa
MPLRLVQAGRYKAPGQWARRPAAPGNSAAPPPPAARPARPGAPRSPGRRASSPACGPSPC
AARPTRDRPPDGAFWPPGLPACVFXSGPASGPSVPTGRAMPSRRVARPSAAPELGALGSA
DLSSLSLAVSRTTDELEIIDEYIKENGFGLEGAQPGPGEGLPRLVSRGAASLSTVTLGPR
GPPPPATPPPWGCPLGRILPPAPGPGPRPHLVITEQPKQRGMRFRYECEGRSAGSILGES
STEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHV
SPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRD
QQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVV
FSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFT
YLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRRKKPAFLDHFLPNHGSGPFLP
PSALLPDTDFFPGPVSLPGLEPPGGPDLLDDSFAYDDATAPTLFTMLDMLPPAPPLASAV
TGNGAAGPTVGEPSGPEPMTLDSYQAPGPGDGGTASLVGSNMFPNQYREVGFGGGLLSPG
PEAT
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgcctctgaggctggtgcaagctgggagatataaggccccaggccaatgggcgcgcagg
ccggcggcgccggggaattccgccgccccgcccccgcccgccgcccgcccggcccggccc
ggcgccccccgcagccccgggcgccgcgcgtccagcccggcctgtggccccagcccctgc
gccgctcgcccgacccgcgatcgtcctccggacggtgccttctggccgcccggcctgccc
gcgtgtgtgttttgatctgggccggcctccgggccgtccgtccccactggtcgggccatg
ccgagtcgccgcgtcgccagaccgtccgctgcgccggagctgggggccttggggtccgct
gacctctcctcgctctcgctcgccgtttccaggaccacggatgaattggagatcatcgac
gagtacatcaaggagaacggctttggcctggagggggcgcagccgggcccgggcgaggga
ctgccgcgcctggtgtctcgcggggccgcctccctgagcaccgtcaccctggggccccgc
ggccccccgcccccggccacgccgccgccctggggctgtcccctgggccggatcctgccc
ccggccccgggccccgggccgcggccgcacctggtcatcacggagcagcccaaacagcgc
ggcatgcgcttccgctacgagtgcgagggccgctcggccggcagcatcctcggggagagc
agcacggaggcgagcaagacgctgcccgccatcgagctccgggattgtggagggcttcgg
gaggtggaggtgaccgcctgcctggtgtggaaggattggcctcaccgagtccacccccac
agcctcgtggggaaagactgcaccgacggcgtctgcagggtgaggctccggcctcatgtc
agcccccggcacagctttaacaatctgggcatccagtgtgtgaggaagaaggagattgaa
gccgccattgagcggaagattcagctgggcatcgacccctacaacgctgggtccctgaag
aaccatcaagaggtggacatgaatgtcgtgaggatttgcttccaggcctcatatagggac
cagcagggacagatgcgccggatggaccctgtgctctctgagcccgtctatgacaagaag
tccacaaacacgtcagagctgcggatctgccgaattaacaaggagagtgggccgtgcacg
gggggcgaggagctctatctgctgtgcgacaaggtgcagaaagaggatatatcggtggtg
ttcagcagggcctcctgggaaggccgggcagacttctcccaggccgatgtgcaccgccag
atcgccattgtgttcaagacaccgccctatgaggacctggaaatcgttgagcctgtgacc
gtgaacgtcttcctgcagcggctcaccgacggggtctgcagtgaacctctgcccttcacg
tacctgcctcgggaccatgacagctacggagtggacaagaagcggaaacgggggatgccg
gacgtccttggggagctgaacagctccgacccccatggcatcgagagcaaacggcggagg
aaaaagccggccttcctggatcacttcctgcccaaccacggctcaggcccgttcctcccg
ccgtcagccctgctgccggatacagacttcttccctggccccgtgtccctacccggcctg
gagcccccaggggggccggacctcctggacgacagctttgcctacgatgacgccacagcc
cccacactcttcaccatgctggacatgttgcccccggcgccgccactcgccagcgctgtc
acgggcaacggggctgcagggcccactgttggagagccttccggccccgagccaatgaca
ctggactcataccaggccccaggccccggggacgggggcactgccagccttgtgggcagc
aacatgttccccaaccagtaccgcgaggtcggatttgggggagggctcctgtccccgggg
cccgaggccacgtag

DBGET integrated database retrieval system