KEGG   Felis catus (domestic cat): 101085906
Entry
101085906         CDS       T02385                                 
Symbol
PTAFR
Name
(RefSeq) platelet-activating factor receptor
  KO
K04279  platelet-activating factor receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101085906 (PTAFR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101085906 (PTAFR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101085906 (PTAFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101085906 (PTAFR)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Others
   Platelet activating factor
    101085906 (PTAFR)
SSDB
Motif
Pfam: 7tm_1 Tmemb_9 UPF0182
Other DBs
NCBI-GeneID: 101085906
NCBI-ProteinID: XP_006934536
Ensembl: ENSFCAG00000012031
LinkDB
Position
C1:complement(21236918..21268596)
AA seq 342 aa
MEPSDSSRVDSEFRYTLFPIVYSIIFVLGVIANSYVLWVFACLYPSKKLNEIKIFMVNLT
MADLLFLVTLPLWIIYYYNQGNWILPRFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT
RPIKTAQATTRKRGFSVSLVIWVAIVAAASYFFVLDSTNVVPNQTGSGNITRCFEHYEKG
SVPVLVVHIFLVISFFLVFFLILFCNLVIIRRLLTQPVQLQRNAEVKRRALWMVCTVLAV
FIICFVPHHIVQLPWTLAELDIRRGDFHQSVNDAHQVTLCLLSTNCVLDPIIYCFLTKKF
RKHLTEKFYNMRSTRKCSRATSETGTEVVMPLSQNPANCLKN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggagccaagcgattcttctcgtgtggactctgagtttcgatacaccctcttcccgatt
gtttacagcatcatctttgtgctgggggtgatcgccaacagctacgtgctgtgggtcttt
gcctgcctgtacccttctaagaaactcaacgagataaagatcttcatggtgaacctcacc
atggctgacctgcttttcttggtcactctgcccctgtggatcatctactactacaaccag
ggcaactggattctccccagattcctctgcaacctggccggctgcttcttcttcatcaac
acctactgctccgtggccttcctggctgtcatcacgtacaaccgtttccaggcggtgaca
cggcccatcaagaccgcccaggccaccacccgcaagcgtggcttctccgtgtccctggtt
atctgggtggccatcgtggccgccgcctcctacttcttcgtcctggactccaccaacgtg
gtgccgaaccagaccggctcgggcaacatcacgcgctgctttgagcattatgagaagggc
agcgtgcctgtcctcgtcgttcacatcttcctcgtgatcagcttcttcctcgtcttcttc
ctcatcctcttctgcaacctggtcatcatccgcaggctgctcacgcagccggtgcagctg
cagcggaacgcggaagtcaagcgccgggctctgtggatggtctgcacggtcttggccgtg
ttcatcatctgcttcgtgccccaccacatcgtgcagctgccctggaccctggctgagctg
gacatccggaggggcgacttccaccagtctgttaacgatgcccatcaggtcaccctctgc
cttcttagcaccaactgcgtcttagaccccatcatctactgtttcctcaccaagaagttt
cgcaagcacctcactgagaagttctacaacatgcgcagcacccggaagtgctcccgggct
acctcggagaccggcaccgaagtggtcatgccgctcagccagaaccctgccaattgtctc
aaaaattag

DBGET integrated database retrieval system