KEGG   Felis catus (domestic cat): 101085930
Entry
101085930         CDS       T02385                                 
Symbol
IL11RA
Name
(RefSeq) interleukin-11 receptor subunit alpha isoform X5
  KO
K05056  interleukin 11 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101085930 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101085930 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101085930 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101085930 (IL11RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101085930 (IL11RA)
SSDB
Motif
Pfam: ig fn3 Ig_3 EpoR_lig-bind Ig_2
Other DBs
NCBI-GeneID: 101085930
NCBI-ProteinID: XP_003995632
Ensembl: ENSFCAG00000003158
UniProt: A0A2I2V0P2
LinkDB
Position
D4:58464742..58480846
AA seq 422 aa
MSSSCSGLSRVLVAAAIALVSTSSPCPQAWGPPGVQYGQPGRSMTLCCPGVTSGAPVSWF
RDGETRLLQGPDSGLGHELVLARADSTDEGTYICRTLDGALKGIVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCPQDPPGASRC
VVHGAEFWSQYRINVTEVNPLGVSTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSIGPLPKEIPAGGQPHKQLEEEPQADCPASPRPSLLPDPRPLDHR
DPLEQVAVLASLGIFSFLGLAAGALALGLWLRLRPDGKDGPQKPGFLAPVIPVDKLPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgcggctatagccctggtg
tccacctcctccccctgcccccaggcctggggccccccaggggtccagtatgggcagcct
ggcaggtccatgacactgtgttgccctggagtgacttctggggccccggtgtcctggttt
cgggatggggagacaaggctgctccaaggacctgactctgggctagggcatgaactggtc
ttggcccgggcagacagcactgatgaaggcacctacatctgccggaccctggatggtgca
cttaagggcattgtgaccctacagctgggctaccccccagcccgccctgttgtctcctgc
caagcagctgactatgagaacttctcctgcacttggagccccagtcaggtcagcggttta
cccacccgctacctcacctcctacaggaagaagacagtaccaggagctgatggccagagg
atgagtccatccacagggccctggccatgcccacaggatcccccaggggcttcccgctgt
gtagtccatggggcagaattctggagccagtaccgaatcaatgtgactgaggtgaacccc
ctaggggtcagtacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
cctcaggggcttcgagtagagtcggtacctggctacccccgccgcctgcgtgccagctgg
acatacccggcctcctggccccgccagccccactttctgctcaagttccgactgcagtac
cgtccagcgcagcatccagcctggtccacggtggagccagctggattggaggaagtgatc
acggatgctgtggctgggctgccccatgctgtacgagtcagtgcccgggactttctggat
gctggcacctggagtgcctggagccctgaggcctgggggactccaagcattgggcccctg
ccaaaggagataccagctgggggccagccacacaagcagctggaggaggagcctcaggca
gactgccccgcttcccccaggccctccctcttgccagatccacggccacttgaccacagg
gaccccctggagcaggtagcggtgctggcatctttgggaatattctctttcctcggactg
gcggctggggccctggcactggggctctggctgagactgagaccagatggtaaggatgga
ccccaaaagcctgggttcttggctccagtgattccagtggacaaacttccaggagcccca
aacctgtag

DBGET integrated database retrieval system