KEGG   Felis catus (domestic cat): 101085940
Entry
101085940         CDS       T02385                                 
Symbol
ITGAL
Name
(RefSeq) integrin alpha-L isoform X1
  KO
K05718  integrin alpha L
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04514  Cell adhesion molecules
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05144  Malaria
fca05150  Staphylococcus aureus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05323  Rheumatoid arthritis
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101085940 (ITGAL)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101085940 (ITGAL)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101085940 (ITGAL)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101085940 (ITGAL)
   04650 Natural killer cell mediated cytotoxicity
    101085940 (ITGAL)
   04670 Leukocyte transendothelial migration
    101085940 (ITGAL)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085940 (ITGAL)
   05169 Epstein-Barr virus infection
    101085940 (ITGAL)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101085940 (ITGAL)
  09174 Infectious disease: parasitic
   05144 Malaria
    101085940 (ITGAL)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101085940 (ITGAL)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101085940 (ITGAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101085940 (ITGAL)
   04515 Cell adhesion molecules [BR:fca04515]
    101085940 (ITGAL)
   04090 CD molecules [BR:fca04090]
    101085940 (ITGAL)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101085940 (ITGAL)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101085940 (ITGAL)
CD molecules [BR:fca04090]
 Proteins
  101085940 (ITGAL)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 HisK_sensor
Other DBs
NCBI-GeneID: 101085940
NCBI-ProteinID: XP_006942210
Ensembl: ENSFCAG00000009795
LinkDB
Position
E3:complement(20954154..20997171)
AA seq 1244 aa
MRFHNPYRLTPTQCHQAGASVRKSHCKRPWGIVIFLFHPVWVVSESPGLSEPGAFLGQVP
AAAGRMNSCTIVVRLLLSGPLFFAQVSSYNLEVRHVQNFSFPQAGRHFGYRVLQVGDWVV
VGAPGEGNSTGNLYQCQAGTGHCIPVSLHGSNYTSKYLGMTLATDATKGSLLACDPGLSR
TCDQNVYLSGLCYLFDQNLKGPVLQSHPGYQECIKGNVDLVFLFDGSMSLQQDEFQKILD
FMKDVMRKLSNSSYQFAAVQFSTECKTEFGFLDYVRVKNPDALLGKVKHMRLLTNTFHAI
NYVTKEVFQQDRGARPDATKVLIIITDGEATDSDQNIDSAKDIIRYIIGIGKHFETKESQ
ETLHKFASKPAKEFVKILATFEKLKDLFTELQKKIYAIEGTSKQDLTSFNMELSSSGISA
DLSQGHGVVGAVGAKDWAGGFLDMDAKLQDDRFVGNEPLTPEARAGYLGYTVTWLPSDKT
LTSLLAVGAPRYQHVGRVLLFQELKGRGHWSQVQKIDGIQIGSYFGGELCGVDMDQDGET
ELLLIGAPLFYGEQRGGRVFVYQRKQLEFEVVSELQGDPGYPLGRFGAAITALTDINGDE
LADVAVGAPLEGQGAVYIFNGQHGGLSPQPSQRIEGAQLFSGIRWFGRSIHGVKDLGGDG
LTDVAVGAEGQVIILSSRPVVDVLTLMSFSPAEIPVHEVECSYSASNKKKEGVNITVCFQ
VKPITPQFQGHLVATLTYTLQLDGHRTRSRGLFPGGRRELSRNTEVTQDESCTKFWFHFP
VCIQDLISPINVSLNFSLREEEGTPRDQWLQGQDIQPILRPLPHAETKEIPFEKNCGEDK
ECEANLKLSFSPARSRVLRLTPSASLSVELMLSNLREDAYWVQLNLSFPQGLSFRKVEIL
EPHSQIPVSCEELPQESKLLTRTLSCNVSSPIFKAGTLVAIQVMFHKLLNSSWGDFVELH
ASVNCDNEDSDLLEDNSATTSIPVLYPINILTKDQENSTLYVNFTPKGPKIRHAKHIYEV
RIQPSAYDHNVPPLEALVGVPESHSKGPIKHEWTVQILPRGGQHTQDPSVTCHREDPETL
PTVAEPCLPEAKFRCPLMFKQEILVQVIGTMELVEEIKASSMLSLCSSLSISFNSSKHFH
LYDDSASLAQVIMKVDIVYEKDMLYVYVLSSTGGLLLFLVILGVLYKLGFFKRNLKEKME
ATVEASNGIPREDSGQPEPKEEGGDPGCLEPLQEEETQDGNDKD
NT seq 3735 nt   +upstreamnt  +downstreamnt
atgcggtttcacaacccctacaggctcacccccacccagtgtcaccaggctggcgcctct
gtgagaaagtcccactgcaagaggccctggggcattgtcattttcctcttccaccctgtc
tgggttgtcagcgaatccccagggctctctgaacctggagccttccttggtcaggtccct
gcggccgctggaaggatgaattcctgcaccatcgtagtgaggctgctgctgtctgggcct
cttttctttgcccaggtctccagctacaacctggaagtccgccacgtgcaaaacttctcg
ttcccacaagccgggaggcattttgggtaccgcgttctgcaggttggagactgggttgtc
gtaggagctccaggtgaggggaacagcactggaaacctctatcagtgccaggcaggcact
ggccactgcatcccagtcagcctgcatggttccaactatacctccaagtacttgggaatg
accctggcgacagacgccacaaagggaagccttttggcctgtgaccctggactgtctcgg
acatgtgaccagaatgtttatctgagtggcctgtgttaccttttcgaccagaatctgaag
ggtcctgtgctgcaaagtcatcctggttatcaggaatgtataaagggcaacgtagacttg
gtatttctgtttgatggttcaatgagcctgcagcaagatgaatttcagaaaattctggac
ttcatgaaggatgtgatgaggaaactcagcaactcttcctatcagtttgctgcggttcag
ttttccacggaatgcaaaacagaatttggtttcttggattatgttagggtgaagaaccct
gatgctctgctgggcaaagtaaaacatatgcggctgttgaccaatacctttcatgccatc
aactatgtcacgaaagaggtgttccagcaagaccggggggcccggccagatgccaccaaa
gtgcttatcatcatcactgacggggaagccactgactcagatcagaacattgactcagcc
aaagacatcatccgctacatcattgggatcggaaagcattttgaaaccaaggaaagtcag
gaaacgctccacaagtttgcctcaaaacctgcaaaggagtttgtaaagattctggccacg
ttcgagaagcttaaagatctgttcactgagctgcaaaagaagatctatgccattgagggc
acgagcaaacaggacctgacatccttcaacatggagctgtcctccagtgggatcagcgct
gacctcagccagggtcatggtgtcgtgggggcagtcggagccaaggattgggctgggggc
tttctagacatggatgccaaactgcaggatgatagatttgttgggaatgaaccgctgaca
ccagaagcaagagcaggatatttaggttacactgtgacctggctgccctccgacaaaacg
ctcacatcgctgctggcggttggagccccccgataccagcatgtggggcgggtgctgctg
ttccaggagctgaagggcagaggacactggagccaggtccagaaaatagacgggatccag
attggctcttatttcggtggcgagctgtgtggcgttgacatggaccaagacggggagaca
gagttgctgctgattggagcccccctgttctatggggagcagaggggaggcagggtgttt
gtctaccagagaaaacagctggagttcgaagtggtctcagaactgcagggggatcctggc
taccctctcgggcgatttggagcagcgatcacggccctgaccgacatcaatggggacgag
ctggcggacgtggctgtgggggcccctctggaggggcagggggctgtgtacatcttcaat
gggcagcatggtgggctgagcccccagccaagccagcggatagaaggggcccagctgttc
tcaggaattcggtggtttggacgctccattcatggggtgaaagaccttggaggagatggc
ctgacagatgtggctgtgggagcggaagggcaggtgatcatactcagctcccggcctgta
gtagatgtcctcactctgatgtccttctccccggctgagatcccagtgcatgaagtggaa
tgctcctattcagccagtaacaagaagaaagaaggagttaacatcacagtctgtttccag
gttaagcctattaccccccaatttcaagggcacctggttgccaccctcacttacactctg
cagctggatggccatcggaccagaagccgggggctgttcccaggaggtagacgtgaactc
agcaggaacacagaggtcacccaagacgagtcctgcaccaagttctggttccacttcccg
gtgtgcattcaagacctcatctctcccatcaacgtctccctaaatttctctctccgggaa
gaagaagggacaccaagggatcaatggctgcagggccaggacattcagcccatcctgaga
cccttaccgcatgcagagaccaaggagatcccttttgagaagaattgcggggaggacaag
gagtgtgaggcgaacctgaagctgtccttctcccctgcaagatccagagtcctacgtctg
acgccctctgccagcctctccgtagagctgatgctgagtaacttgagagaagatgcctac
tgggtccaactcaacctgagcttcccccagggactctccttccgcaaagtagagatactc
gagccccacagccagatacccgtgagctgcgaggagcttcctcaggaatccaagcttctg
accaggaccctctcttgcaacgtgagctctccgatctttaaagcgggcaccttggttgcc
atccaggtgatgttccacaagctgctgaacagctcctggggggactttgtcgagctgcac
gccagtgtgaactgtgacaatgaggactcagacctcttggaggacaactctgccaccacc
agcatcccagtcctgtaccccatcaacatcctcaccaaggaccaggaaaactccacactg
tatgtcaacttcacccccaagggtcccaagatccgccatgccaaacacatctacgaggtg
aggattcagccttctgcctatgaccacaacgtgccccccctggaggccttggtcggggta
ccagagtcacacagcaaggggcccatcaaacacgagtggactgtgcagatcctgcccaga
ggagggcaacacacccaggatccttctgtgacctgccaccgtgaggatccggagacgctg
cccactgtggctgagccttgtttgcccgaagccaagttccgctgcccacttatgttcaag
caggagatcctcgtccaagtgatcgggacaatggagctggtggaggagatcaaggcctcc
tccatgctcagcctctgtagctctctctccatctccttcaacagcagcaagcacttccac
ctgtatgatgacagtgcctccctggcccaggtcatcatgaaggtggacatcgtatatgag
aaggacatgctctacgtctacgtgctgagcagcactgggggactattgttgttcctggtg
attctcggggtactctacaagctcggcttcttcaaacggaatctgaaggagaagatggag
gctaccgtagaagcttcgaatggaatccctagagaagactctggacaaccagagcccaag
gaagagggtggggatccgggctgcctggagcccctccaggaggaggagacccaggatgga
aatgacaaagactga

DBGET integrated database retrieval system