KEGG   Felis catus (domestic cat): 101085959
Entry
101085959         CDS       T02385                                 
Symbol
RAB7A
Name
(RefSeq) ras-related protein Rab-7a
  KO
K07897  Ras-related protein Rab-7A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04144  Endocytosis
fca04145  Phagosome
fca05132  Salmonella infection
fca05146  Amoebiasis
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101085959 (RAB7A)
   04145 Phagosome
    101085959 (RAB7A)
   04140 Autophagy - animal
    101085959 (RAB7A)
   04137 Mitophagy - animal
    101085959 (RAB7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101085959 (RAB7A)
   05152 Tuberculosis
    101085959 (RAB7A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101085959 (RAB7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085959 (RAB7A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101085959 (RAB7A)
   04031 GTP-binding proteins [BR:fca04031]
    101085959 (RAB7A)
Membrane trafficking [BR:fca04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    101085959 (RAB7A)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101085959 (RAB7A)
  Exosomal proteins of other body fluids (saliva and urine)
   101085959 (RAB7A)
  Exosomal proteins of colorectal cancer cells
   101085959 (RAB7A)
  Exosomal proteins of bladder cancer cells
   101085959 (RAB7A)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    101085959 (RAB7A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU cobW ATP_bind_1 PduV-EutP Septin AAA_22 NTPase_1 AAA_16 AAA_7 SRPRB AAA_24 AAA_5 G-alpha ATPase_2 NACHT NB-ARC TniB
Other DBs
NCBI-GeneID: 101085959
NCBI-ProteinID: XP_011278541
Ensembl: ENSFCAG00000022971
UniProt: M3WRD9
LinkDB
Position
A2:complement(57012891..57084922)
AA seq 207 aa
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt
aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca
ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag
atctgggacacagcaggacaggaacggttccagtcccttggtgtggccttctacagaggc
gcagactgctgcgttctggtatttgacgtcactgcccccaacacattcaaaacccttgat
agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc
gtggtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag
gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc
aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacagaggtg
gagctgtacaacgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc
tcggcggaaagctgcagttgctga

DBGET integrated database retrieval system