Felis catus (domestic cat): 101085959 Help Entry 101085959         CDS       T02385                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism fca  Felis catus (domestic cat) Pathway fca04137   Mitophagy - animal fca04140   Autophagy - animal fca04144   Endocytosis fca04145   Phagosome fca04148   Efferocytosis fca05132   Salmonella infection fca05146   Amoebiasis fca05152   Tuberculosis Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101085959 (RAB7A)    04145 Phagosome     101085959 (RAB7A)    04140 Autophagy - animal     101085959 (RAB7A)    04137 Mitophagy - animal     101085959 (RAB7A)    04148 Efferocytosis     101085959 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101085959 (RAB7A)    05152 Tuberculosis     101085959 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     101085959 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101085959 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101085959 (RAB7A)    04031 GTP-binding proteins [BR:fca04031]     101085959 (RAB7A) Membrane trafficking [BR:fca04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101085959 (RAB7A) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101085959 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    101085959 (RAB7A)   Exosomal proteins of colorectal cancer cells    101085959 (RAB7A)   Exosomal proteins of bladder cancer cells    101085959 (RAB7A) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101085959 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  101085959 NCBI-ProteinID:  XP_011278541 UniProt:  M3WRD9 LinkDB All DBs Position A2:complement(57196188..57267439) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggacaggaacggttccagtcccttggtgtggccttctacagaggc gcagactgctgcgttctggtatttgacgtcactgcccccaacacattcaaaacccttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gtggtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggaaagctgcagttgctga

DBGET integrated database retrieval system