KEGG   Felis catus (domestic cat): 101085996
Entry
101085996         CDS       T02385                                 
Name
(RefSeq) interferon-induced GTP-binding protein Mx1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
fca  Felis catus (domestic cat)
Pathway
fca03250  Viral life cycle - HIV-1
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    101085996
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101085996
   05171 Coronavirus disease - COVID-19
    101085996
   05164 Influenza A
    101085996
   05162 Measles
    101085996
   05165 Human papillomavirus infection
    101085996
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 ABC_tran AAA_16 AAA_21 AAA_29 PP_kinase_N
Other DBs
NCBI-GeneID: 101085996
NCBI-ProteinID: XP_023094481
Ensembl: ENSFCAG00000008068
LinkDB
Position
C2:complement(4506567..4534004)
AA seq 660 aa
MVNSKGKITDSDPVSDHLLLNGLADKAEKNQETGLKKNLCSQYEEKVRPCIDLIDSLRAL
GVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLMNEDEWRG
KVSYQDFETEISDPSEVEEAINTAQNAIAGEGLGISHELINLEVSSPHVPDLTLIDLPGI
TRVAVGNQPADIGRQTKQLIRKYIVKQETINLVVVPCNVDIATTEALSMAQEVDPDGDRT
IGILTKPDLVDRGTEDKVVDVAQNLVCHLKKGYMVVKCRGQQDIQDQLSLAEALEKERVF
FEDHPHFRVLLEEGRATVPCLADRLTTELIMHICKSLPLLENQIKENHEKITEELQKYGS
DVPEDEHEKMFFLIDKINAFNHDITSLIQGEESVGEGESRLFTKIRHEFHKWSTVIEKKF
QKGYKAIYKEIEKFENRYRGRELPGFVNYKTFEIIIKQQIRELEEPAVDMLRTVTDMVQL
AFANISKGNFDEFFNLYRTTKSKIEDIKFELENEAEKSIRLHFQMEQIVYCQDQIYQRAL
QRVRERVSEEEKRNKKINSPISEEVSSGSVSLCEIFEHLLAYRQEAANRISSHIPLIIQY
FILQVYGQRLQKNMLQLLQDKETYSWLLKERSDTSDKRKFLKERLARLAQARRRLAKFPG
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggttaattctaaaggaaagatcactgactcagatcctgtatccgatcatctgttacta
aatggacttgcggataaggcagagaaaaatcaggaaacgggactcaagaagaacctatgt
agccagtacgaggagaaagtgcgcccctgcattgacctcatcgactcccttcgtgccctg
ggcgtggagcaggacctggccctgcctgccatcgctgtcatcggagaccagagctcgggc
aagagctcagtgctggaggccctgtcaggggtcgcccttcccagaggcagcggtattgtc
acaaggtgtcctctggtgctgaagctgaagaagctcatgaatgaggatgaatggagaggc
aaagtcagctaccaggactttgagacggagatttcagacccttcggaggtggaggaggca
atcaatacagcccagaatgccatcgccggggaaggactggggatcagtcatgagctaatc
aacctggaggtcagctcccctcatgtcccggatctgaccctgatagacctccctggcatc
accagggtggcagtgggcaatcagccggccgacatcggacgccagaccaagcaactcatc
aggaagtacatcgttaagcaggagacaatcaacctggtggtggtcccttgcaatgtggac
atcgccaccacagaggcactgagcatggctcaggaggtggaccccgatggagacaggacc
ataggcatcttgacaaagcctgacctggtggacagaggcaccgaggacaaggtggtcgac
gtggcacaaaacctcgtctgtcacctgaagaagggctacatggtcgtcaagtgccggggc
cagcaggacatccaggaccagctgagcctggccgaggctctggagaaagagagagtcttc
tttgaggaccacccacatttcagggttctcctggaggaaggaagggccaccgtgccctgt
ctggcggacagactgaccactgaactcatcatgcacatctgcaaatctctgcccctgtta
gagaatcaaataaaggagaatcatgagaaaataacagaggaattacaaaagtatggctca
gatgtaccagaagacgaacacgaaaaaatgttttttctaatagataaaatcaatgcgttt
aatcatgacattacctctttaatacaaggggaggagtctgtgggggagggtgagagtcgg
ctgttcaccaaaatcagacatgaattccacaagtggagcaccgtgattgaaaagaagttc
cagaaagggtacaaagcgatatataaagaaattgagaaatttgaaaatcggtatcggggc
agagagctgccgggatttgtcaattacaagacgtttgagattattatcaaacagcaaatc
agagagctggaggagccagctgtcgacatgctgcgcacggtaactgatatggtccagctt
gcctttgcaaatatttcgaaaggaaactttgatgaatttttcaacctctacagaacaacc
aagtccaaaatcgaagacattaagtttgaactggaaaacgaagcggagaagtcgatccga
cttcacttccaaatggagcagattgtctactgtcaggaccagatctaccagcgggcgctg
cagagggtcagggagagggtttcggaggaggagaagaggaataaaaaaataaacagtccg
atctctgaagaagtttcttcagggagcgtctccttgtgtgaaatctttgagcacctgctg
gcctaccgccaggaggccgccaaccggatctccagccacatccccctgatcatccagtac
ttcatcctgcaagtgtacggccagcggctgcagaagaatatgctgcagctgctgcaggac
aaggagacctacagctggctcctgaaggagcgcagcgacaccagcgacaagaggaagttc
ctgaaggagcggctcgcgcggctggcccaggctcggcgccgcctggccaagttccccggt
taa

DBGET integrated database retrieval system