KEGG   Felis catus (domestic cat): 101086055
Entry
101086055         CDS       T02385                                 
Symbol
FGFR1
Name
(RefSeq) fibroblast growth factor receptor 1 isoform X3
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04714  Thermogenesis
fca04810  Regulation of actin cytoskeleton
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05215  Prostate cancer
fca05218  Melanoma
fca05224  Breast cancer
fca05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086055 (FGFR1)
   04014 Ras signaling pathway
    101086055 (FGFR1)
   04015 Rap1 signaling pathway
    101086055 (FGFR1)
   04020 Calcium signaling pathway
    101086055 (FGFR1)
   04151 PI3K-Akt signaling pathway
    101086055 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101086055 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101086055 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101086055 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101086055 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101086055 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086055 (FGFR1)
   05205 Proteoglycans in cancer
    101086055 (FGFR1)
   05230 Central carbon metabolism in cancer
    101086055 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    101086055 (FGFR1)
   05215 Prostate cancer
    101086055 (FGFR1)
   05224 Breast cancer
    101086055 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086055 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101086055 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101086055 (FGFR1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101086055 (FGFR1)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   101086055 (FGFR1)
CD molecules [BR:fca04090]
 Proteins
  101086055 (FGFR1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101086055 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 C2-set_2 Ig_4 ABC1 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 101086055
NCBI-ProteinID: XP_011279822
Ensembl: ENSFCAG00000013612
UniProt: H9U391
LinkDB
Position
B1:46389479..46442112
AA seq 821 aa
MWSWKYLLLAVLVTATLCTARPAPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDV
QSINWLRDGVQLVESNRTRITGEEVEVRDSVPADSGLYACVTSSPSGSDTTYFSVNVSDA
LPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSS
GTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINH
TYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIG
PDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEA
LEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKSI
PLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLG
KPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKH
KNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLV
SCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGR
LPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDK
PSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFP
DTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2466 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtacctcctcttggctgtgctggtcacagccacgctctgcactgcc
aggccagccccgaccttgcccgaacaagcccagccctggggagcccctgtggaagtggag
tccttcctggtccaccctggtgacctgctacagcttcgctgtcggctgcgggacgatgtc
cagagcatcaactggctgcgggacggggtgcagctggtggagagcaaccgtacccgcatc
acaggggaggaggtggaggtgcgggactcggtgcctgccgactccggcctctacgcttgc
gtgaccagcagcccctcgggcagcgacaccacctacttctccgtcaatgtctcagatgct
ctcccctcctcggaggatgacgacgatgatgatgactcctcttcagaggagaaagagaca
gataacaccaaaccaaaccgtatgcccgtggctccatactggacatccccagaaaagatg
gaaaagaaattgcacgcggtgccagctgccaagactgtgaagttcaaatgtccttctagt
gggactcctaaccccacgctgcgctggttgaaaaacggcaaagaattcaaacctgaccac
aggattggaggctataaggtccgttacgccacctggagcatcataatggactccgtagtg
ccttctgataagggcaactacacctgcattgtggagaatgagtatggcagcattaaccac
acctaccagctcgacgtcgtggagcggtcccctcaccggcccatcctgcaggcggggttg
cctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtacagt
gacccacagccccatatccagtggctaaagcacatcgaggtgaatgggagtaagattggt
ccagacaacctgccttatgtccagatcttgaagactgccggagttaacaccaccgacaaa
gagatggaagtgcttcacttaaggaatgtctcctttgaggacgcgggggagtatacgtgc
ttggcgggtaactctatcggactgtcccatcactctgcatggttgaccgttttggaagcc
ctggaagagaggccggcggtgatgacctcgcccctgtacctggagatcatcatctactgc
acgggggccttcctcatctcctgcatggtggggtctgtcatcatctacaaaatgaagagt
ggcaccaagaagagcgacttccacagccagatggccgtgcacaagctggccaagagcatc
ccgctgcgcagacaggtaacagtgtcggctgattctagtgcctccatgaactctggggtt
ctgctggttcggccctcacgtctctcctctagtggaacccccatgctggctggggtctct
gaatatgagcttcctgaagacccacgctgggagctgcctcgagacaggctggttttaggc
aaacccctgggagagggctgctttgggcaggtggtgttggcagaggccatcgggctggac
aaggacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaaca
gagaaagacctgtcagacctgatctcagaaatggagatgatgaagatgatcgggaagcac
aagaacatcatcaacctgctgggggcctgcacgcaggacggtccattgtacgtcatcgtg
gagtatgcctccaaaggcaacctacgggaatacctgcaggcccggcggcccccggggctg
gagtactgttataaccccagccacaacccagaggagcagctctcttccaaggacctggtc
tcctgcgcctatcaggtggcccgaggcatggagtatcttgcctccaagaagtgcatacac
cgagacctggccgccaggaacgtcctggtgacagaggacaacgtgatgaagatcgcagac
ttcggcctcgctcgggacatccaccatattgactactataaaaagacaaccaatggccgg
ctccctgtgaagtggatggcacccgaggccttgtttgaccggatctacacccaccagagt
gacgtctggtcttttggggtgctcctgtgggaaatcttcactctgggaggctccccgtat
cctggcgtgcctgtggaggagcttttcaagctgctgaaggagggtcatcgaatggacaag
cccagtaactgcaccaatgagctatacatgatgatgcgggattgctggcatgcagtaccc
tctcagagacctaccttcaagcagctggtggaagacctggaccgcattgtggccttgacc
tccaaccaggagtatctggacctgtcaatgcccctggaccaatactctcccagctttccc
gacacccgaagctctacctgctcctcaggggaggattccgtcttctctcatgagccgttg
cctgaggagccctgtctgccccgacacccagcccagcttgccaatggcggactcaaacgg
cgctga

DBGET integrated database retrieval system