KEGG   Felis catus (domestic cat): 101086207
Entry
101086207         CDS       T02385                                 
Name
(RefSeq) cytochrome b-245 heavy chain
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04066  HIF-1 signaling pathway
fca04145  Phagosome
fca04216  Ferroptosis
fca04217  Necroptosis
fca04613  Neutrophil extracellular trap formation
fca04621  NOD-like receptor signaling pathway
fca04670  Leukocyte transendothelial migration
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05010  Alzheimer disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05140  Leishmaniasis
fca05171  Coronavirus disease - COVID-19
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101086207
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101086207
  09143 Cell growth and death
   04216 Ferroptosis
    101086207
   04217 Necroptosis
    101086207
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101086207
   04621 NOD-like receptor signaling pathway
    101086207
   04670 Leukocyte transendothelial migration
    101086207
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101086207
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101086207
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101086207
   05020 Prion disease
    101086207
   05022 Pathways of neurodegeneration - multiple diseases
    101086207
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101086207
   05415 Diabetic cardiomyopathy
    101086207
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101086207
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101086207
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.-  
   1.-.-
    1.-.-.-
     101086207
Membrane trafficking [BR:fca04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    101086207
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-GeneID: 101086207
NCBI-ProteinID: XP_004000443
Ensembl: ENSFCAG00000003145
UniProt: M3VZS9
LinkDB
Position
X:33385703..33419837
AA seq 570 aa
MGNWVENEGLSIFVVLIWLGMNVFLFVWYYRIYALRRTFFYTQKLLGIALPLARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHL
FNVEWCVDARSNNSDPYLIALSDLGDNPNETYLNFARKRFKNPEGGLYVAVTRLAGITGI
VITLCLILIITSSTKTIRRSYFELFWYTHHLFVIFFIGLAIHGAERIVRGQTPQSLDEHH
HEICEKRISEWGKIKECPIPQFSGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSRLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLRLKKIYFYWLCRDTHAFEWFADLLQLLETQMLERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLNKQCISNSESGPRGVHFIFNKENF
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggaactgggttgaaaatgagggactctccatctttgtcgttctaatatggctgggg
atgaacgtcttcctctttgtctggtactacagaatctatgcgttgagaaggacattcttt
tacactcaaaaacttctggggatcgcactgccattggccagggcccctgcagcctgcctg
aatttcaactgcatgctgattctgctgccagtctgtcgaaatctgctctccttcctcagg
ggttccagtgcgtgctgctcgacaagaattcgaagacaactggacaggaacctcaccttt
cataaaatggtggcatggatgatcgcacttcacactgcgattcatactattgcacatctg
tttaatgtggagtggtgtgtggatgcccgatccaacaattctgatccttatttaatagca
ctctctgaccttggagataatcctaatgaaacttacctcaattttgctcgaaagagattc
aagaatcctgaaggaggcctatatgtggctgtgactcggttggcaggcatcactggtatt
gtcatcacactgtgcctcatattaattatcacctcctccaccaaaaccatccggagatct
tactttgaactgttttggtacacacaccatctctttgtgatcttcttcatcgggctcgcc
atccacggagctgagcgcattgtacgtgggcagaccccacagagtttagacgaacaccat
cacgaaatttgtgagaaaaggatctcagaatggggaaaaataaaggaatgcccaatccca
cagttttctgggaaccctcctatgacttggaaatggattgttggtcccatgtttctgtat
ctctgtgagaggttggtacggttttggcgatctcaacagaaagtggtcatcaccaaggtg
gtcactcaccctttcaaaaccattgagctacagatgaagaagaagggattcaagatggag
gtgggacaatacattttcgtcaagtgccccaaggtgtccaggctggagtggcaccctttc
acgctgacctccgcccctgaggaagacttctttagcatccatattcgtatcgttggggac
tggacagaaggacttttcaatgcttgtggctgtgataaacaagagtttcaagatgcttgg
aaactacctaagatagctgttgatgggccctttggcaccgccagtgaagacgtgttcagt
tatgaggtggtgatgttggtgggagcagggatcggggtcacacccttcgcatccattctc
aagtccgtctggtacaaatattgcaataatgccaccaatctgaggctcaaaaagatatac
ttctactggctctgccgggacacgcacgcctttgagtggtttgccgacttgctgcagctg
ctggagacccagatgctggagaggaataacgctggcttcctcagctataacatctacctc
accggctgggatgagtctcaggccaatcactttgctgtgcatcacgatgaggagaaagac
gtgatcacaggcctgaaacaaaagaccttgtatggacggcccaactgggataatgaattc
aagacaattgcgagtcaacacccaaataccagaataggagttttcctctgcggacctgaa
gccttggcggaaaccctcaataaacagtgcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system