KEGG   Felis catus (domestic cat): 101086423
Entry
101086423         CDS       T02385                                 
Symbol
BLNK
Name
(RefSeq) B-cell linker protein isoform X1
  KO
K07371  B-cell linker protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04662  B cell receptor signaling pathway
fca05169  Epstein-Barr virus infection
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101086423 (BLNK)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    101086423 (BLNK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101086423 (BLNK)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101086423 (BLNK)
  09163 Immune disease
   05340 Primary immunodeficiency
    101086423 (BLNK)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 101086423
NCBI-ProteinID: XP_006938108
Ensembl: ENSFCAG00000007140
UniProt: M3W765
LinkDB
Position
D2:complement(57561238..57638181)
AA seq 475 aa
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPQRDYASEDLADE
EEQWSDDFTHRVSATLPVKWSTCSPRIVVQDSDYEHPDEHSDSEMYVLPAEETGDDSYEP
PPAEQETRTVHPALPFTRGDYIDNRSSQRQSPPFSKTLPSKPNWPSAKTRLTSTLPALTS
LQKPQVPPKPKDLEDEADYVVPLEDEDENYIHPTESSSLPAEKAPTVNRSTKPNNASKPA
SPPGTASGRNSGAWDAKSPSPAAPSPMPRAGKKPATPLKTTPLTPQQNASTVCEEKPIPA
ERHRASSHRQENMQSSVFPPAQKQIHHKPVPLPRFPEGGSPAVDGQFSSNPHLSEQEADI
HCKPWYAGACDRKSAEEALYRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFI
EATKQYALGRKKNGEEYFGSVAEIIKNHQHRPLVLIDNQNNTKDWTRLKYAVKVS
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggacaagcttaacaaaataactgtccctgccagtcagaagttgaggcaacttcaaaag
atggtccatgacatcaagaacaatgaaggtggaataatgaacaagatcaaaaagctgaaa
gtcaaagcacctccaagtgttcctcaaagggactatgcctcagaggaccttgctgacgaa
gaggagcagtggtcagatgactttacacacagagtttcagccacccttcctgttaaatgg
tccacatgctcccccaggatagtggttcaggacagcgactatgaacacccggacgagcac
tcggactcggagatgtacgtgctccccgcggaagagactggggacgacagttacgagccg
ccgcccgccgagcaggagacgagaaccgttcacccagccctgcccttcaccaggggcgac
tatatagacaatcgatcaagccagaggcagtctccgcccttcagcaagacacttccaagt
aagcccaactggccttcggcaaagacaaggctgacctccactctgccggccctgacttct
cttcagaaacctcaagtcccacccaaacccaaagaccttgaggatgaggctgattatgtg
gttcctctggaggatgaagacgaaaactacattcatcccacagaaagcagttcactccca
gctgaaaaagctcccacggtgaatagatctacgaaaccaaataacgcatcgaagccagcc
tctcctcctgggacagcgtcaggtcgtaacagcggggcctgggacgccaagtcaccttct
cctgctgcgccgtccccaatgccccgggccgggaaaaaaccagctaccccactgaagaca
actccacttacgcctcaacagaacgcttcaactgtttgtgaagaaaaacccatacctgct
gaacgccaccgagcatctagtcacagacaagaaaatatgcagtcatcagtgtttcctcct
gcccagaaacaaatccatcacaaacctgtacctctgccaagatttccagaagggggaagc
ccagctgtggatggccaattttcatctaaccctcatttgtcagaacaggaagctgacatc
cactgcaagccgtggtatgccggtgcctgcgatcgaaagtctgctgaagaggctttatac
agatcaaacaaggatggatcatttcttattcggaaaagctccggccatgattccaaacag
ccatatacactagttgtattctttaataagcgagtatataatatccctgtgagatttatc
gaagcaacaaagcagtatgctttgggcaggaagaaaaatggtgaagagtactttggaagt
gttgctgaaattatcaagaatcatcaacataggcctctggttcttatcgacaatcagaat
aatacaaaagattggacaagattgaaatatgcagttaaagtttcatag

DBGET integrated database retrieval system