Felis catus (domestic cat): 101086477 Help Entry 101086477         CDS       T02385                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101086477  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101086477   09163 Immune disease    05322 Systemic lupus erythematosus     101086477   09165 Substance dependence    05034 Alcoholism     101086477  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101086477   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101086477 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101086477 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101086477 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF6246 Motif Other DBs NCBI-GeneID:  101086477 NCBI-ProteinID:  XP_044914451 EnsemblRapid:  ENSFCTG00005013566 LinkDB All DBs Position B2:3258735..3260394 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggccaagtccgctcccgccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagcgcgaagtaa

DBGET integrated database retrieval system