KEGG   Felis catus (domestic cat): 101086525
Entry
101086525         CDS       T02385                                 
Symbol
CCL26
Name
(RefSeq) C-C motif chemokine 26
  KO
K21096  C-C motif chemokine 26
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086525 (CCL26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086525 (CCL26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101086525 (CCL26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101086525 (CCL26)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101086525 (CCL26)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101086525
NCBI-ProteinID: XP_023102628
LinkDB
Position
E3:9705773..9708715
AA seq 94 aa
MKSLPVGFLVLLIFILSVHLGAATRGSNVAKFCCFQYSHKILPWKWVHAYKFTRNSCSQR
AVIFVTKKGHKVCAQPKEKWVQRYISLLRAQQQM
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagagccttcctgttggctttcttgttctcctgatcttcatcctgagtgtccatctc
ggagctgccacacgtggcagcaatgtggccaagttctgctgcttccaatatagccacaag
atccttccttggaagtgggtgcatgcctataaattcaccaggaacagctgctcccagcgg
gctgtgatattcgttaccaaaaaaggccataaagtctgtgcacagccaaaggaaaaatgg
gtgcaaagatacatttctttactcagagcacagcagcaaatgtga

DBGET integrated database retrieval system