KEGG   Felis catus (domestic cat): 101086565
Entry
101086565         CDS       T02385                                 
Symbol
IL20RA
Name
(RefSeq) interleukin-20 receptor subunit alpha isoform X1
  KO
K05136  interleukin 20 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101086565 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086565 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086565 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101086565 (IL20RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101086565 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101086565
NCBI-ProteinID: XP_006932109
Ensembl: ENSFCAG00000029581
LinkDB
Position
B2:complement(126417447..126452851)
AA seq 503 aa
MRNILQWSPPEGLQEAELTYTVQYFIYGQKKWLNKSECRNINRTCCDLSVETSDYEHQYY
AKVKAIWETNCSKWAETGRFYPFLETQIGPPEVALSTDEKSISIVLTAPEKWKRNPEESS
ISMQQIYSNLKYNVSVYNAKSNRTWSQCVTNRTLVLSWLEPDTLYCVRVETFVPGPPRLA
QPSEKQCVRTQKDQTSALKVKIIFWYVLPISVAVFIFSVMGYSMYRYIHVGKEKHPANLI
LIYGNEFDKRFFVPAEKIVINFITLNILEDSKISHKDMRHVVEKSDDGSDGDEPGRDQRP
RQAEMEVKHLGYASHLVDISCDSGESTQGTSLTQQGSPGRAIPTEKAVVEYEYDVRAADV
CVGPGGPELNLQEKVSLQGTFFEQQAALADVSPQAPLYSYAPQLRHLDQLLQEHVGTEEE
REEEPSTTLVDWDPRTGRLCIPSFPSFEHGSEGDKQPESKELVEEGLLSRLYEEQAPDKP
SEDNETDLLKFMEEWGLYVQMED
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaggaatatcctacagtggagtccgccagagggtctacaagaagctgaacttacttac
actgtgcagtatttcatatatgggcaaaaaaaatggctgaataaatccgaatgtagaaat
atcaataggacctgctgtgatctctctgtggaaacttccgattatgaacatcaatattat
gccaaagttaaggccatttgggaaacgaattgttccaaatgggcagaaaccggacgattc
tatccattcttagagacacaaatcggcccaccagaagttgctttatctacagatgagaaa
tccatttctattgttctgacggctccagagaagtggaagagaaatccagaggaaagttct
atttccatgcaacagatttactctaacctgaagtacaacgtgtccgtatataatgctaag
tctaatagaacgtggtcccagtgtgtgaccaaccgcacgctggtgctcagctggctggag
ccagacaccctgtactgcgtgcgtgtggagacctttgtcccagggccccctcgccttgct
cagccttctgagaagcagtgtgtccgtactcagaaagatcaaacatcagcattgaaggtt
aaaatcatcttctggtatgttttgcccatatctgttgccgtgtttattttttctgtgatg
ggctactccatgtacagatatatccatgttggcaaagagaaacacccagcaaatttgatt
ttgatttatggaaatgaatttgacaaaagattctttgtacctgctgaaaaaattgtgatt
aattttatcaccctcaatattttggaggattctaaaatttctcataaggatatgagacac
gtagtggaaaaaagcgacgacgggtcggatggggatgagcccggcagggaccagcggccg
cgtcaggcggaaatggaggtgaaacacttagggtatgcttcacatctggtggacatttcc
tgtgactctggggaaagcacccagggcacttccctaacccagcaagggtcaccaggcaga
gcaatacccaccgagaaggcagttgttgaatacgaatatgatgtcagagctgcagacgtt
tgtgtggggcctggcggccctgagctcaatttgcaggagaaggtgtccctacaaggaacg
ttctttgagcaacaggctgctttggcagacgtgagcccccaggcaccactgtattcgtat
gcccctcagctccgacacctggaccagttgctgcaggagcacgtgggcacagaagaggag
cgagaggaagagccgtcgaccacactggtggattgggaccctcggaccggcaggctgtgc
ataccgtccttccctagctttgaacatggctcagagggagacaagcagcctgagtccaag
gagctcgtggaggagggccttttgtctagactgtatgaggagcaggctccagacaagccg
tcggaagacaacgaaaccgacctcctgaaatttatggaggaatggggactctatgtgcag
atggaagactga

DBGET integrated database retrieval system