Felis catus (domestic cat): 101086638 Help Entry 101086638         CDS       T02385                                  Symbol BRK1 Name (RefSeq) protein BRICK1 isoform X2   KO K05752   chromosome 3 open reading frame 10 Organism fca  Felis catus (domestic cat) Pathway fca04810   Regulation of actin cytoskeleton fca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101086638 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101086638 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  101086638 NCBI-ProteinID:  XP_003982515 UniProt:  M3WEQ1 LinkDB All DBs Position A2:51370558..51385749 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactcgttcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagccctcgaacggaga atagagtacattgaagcacgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system