KEGG   Felis catus (domestic cat): 101086649
Entry
101086649         CDS       T02385                                 
Symbol
CFI
Name
(RefSeq) complement factor I isoform X1
  KO
K01333  complement factor I [EC:3.4.21.45]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101086649 (CFI)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101086649 (CFI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101086649 (CFI)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101086649 (CFI)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.45  complement factor I
     101086649 (CFI)
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101086649 (CFI)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101086649 (CFI)
SSDB
Motif
Pfam: Trypsin Ldl_recept_a SRCR Trypsin_2 DUF5675 DUF1986
Other DBs
NCBI-GeneID: 101086649
NCBI-ProteinID: XP_006930977
LinkDB
Position
B1:115585863..115643211
AA seq 618 aa
MKLAHVILLFLCFYKSFCKDTDENQEQWTKKPQLPSTSYIPQKDLLDNKCLIEKYTHLSC
KKVFCQPWQKCIDGTCICKLPYQCPKNGTSVCSTNGKSYLTYCQQKSFECLQPTAKFLNS
GTCIAEGQFSVSLKYGTTTSEGIVEVKLVDQDKKMFICKKAWSIVEANVACLELGFQQGA
LEAQKSFEVPEDLHINSTECLHVHCRGLETSLAECTFIKRRTKNYQDLAGVVCYTQNTVS
SANDSFRCVNGKYIPQKKTCNGVNDCGDQSDELCCKGCRGKSFLCKSGVCIPNKYKCNGE
LDCITGEDEIGCKGERRIDLTHVSGDDDHRPGHSEIKEETELLTANMDAERKRIKSLLPK
LSCGVKPIRPTRRKRVVGGKPAEVGDFPWQVAIKDNEKINCGGIYIGGCWILTAAHCVSV
SKAHHYQIWTSFLHLLRPEEELVVQLANKIIIHENYNGSSYENDIALIEMKKHSKRKECV
LPNSVPACVPWSPYLFQPNDRCIISGWGREKDNQKVYSLQWGEVKLLDNCSKFYPGRYFE
KKMECAGTDDGSIDACKGDSGGPLVCQDINNVTYVWGVVSWGENCGKPEFPGIYTKVANY
FDWISYHVGRSLISQYNI
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgaagctcgctcatgttattttgttatttttgtgcttctacaaaagtttttgcaaggat
acagatgaaaatcaagaacaatggacaaagaaaccacagcttccttcgacatcatacata
cctcaaaaggatctgctagacaacaagtgcctaattgaaaaatacacacatctctcctgc
aaaaaagtcttctgtcaaccatggcagaaatgcatcgatgggacctgtatctgtaaactc
ccttatcagtgcccaaagaatggtacttcagtgtgttcaactaatgggaaaagctaccta
acttactgtcagcagaagagttttgaatgtcttcagccaacggcaaagtttttaaatagt
ggaacatgcatagctgaaggacaatttagtgtttccttaaagtatggaactaccacttct
gagggaattgttgaagtaaaacttgtagaccaagataagaaaatgttcatatgtaaaaaa
gcctggagcatagtggaggctaatgtggcctgtcttgaacttggatttcaacaaggtgct
ttggaggctcaaaaaagttttgaagttcctgaagatctccatataaattctaccgaatgt
ctgcatgtgcattgtcgaggattagaaactagtttggctgaatgcacttttattaagaga
agaactaaaaattaccaggatttagctggtgtggtatgttacacacagaatacagtttct
tcagcaaatgactcctttcgttgtgtgaatgggaaatatattcctcaaaagaaaacctgt
aatggtgtcaatgactgtggagaccaaagtgatgagctgtgctgtaaaggatgccgaggc
aaaagtttcctttgtaaatccggtgtttgtattccaaataagtataagtgcaatggtgag
ctggactgcattacaggagaagatgaaattggttgtaaaggtgaacggcgtattgatctg
acacatgtatcaggagatgatgaccacagacctggacattctgaaattaaagaagaaaca
gaacttttgactgctaatatggatgcagaacgaaaacggataaagtcacttctccctaaa
ctatcctgtggagttaaacccatccggcccactcgaaggaaacgagttgtcggaggaaag
ccagcagaagtgggagacttcccgtggcaggtggcaattaaggataatgagaaaatcaac
tgtggaggaatttatattggaggctgttggattctaactgctgcacactgtgtcagtgtc
agtaaagctcaccattaccaaatatggacatcatttctacatctgttaagacctgaggaa
gagctagttgttcagctagcaaataaaattattatccatgaaaactacaatggaagcagc
tatgaaaatgacatagctttgattgaaatgaaaaaacactcaaagagaaaagaatgtgtg
ctgcctaattctgtccctgcctgtgtcccctggtctccatatctattccaacctaatgac
agatgcattatttctggctggggccgagaaaaagataaccaaaaagtctattcacttcag
tggggtgaagttaagctactagacaactgctccaagttttacccaggtcgctactttgaa
aaaaaaatggaatgtgcaggtacagatgacggttccatcgatgcctgtaaaggggactct
ggaggccccttagtctgtcaagatatcaacaatgtgacttatgtttggggtgttgtgagt
tggggtgaaaactgcggaaaaccagagttccctggtatttacactaaagtggccaattat
tttgactggattagctatcatgtaggaaggtctcttatttctcagtacaacatatga

DBGET integrated database retrieval system