KEGG   Felis catus (domestic cat): 101087092
Entry
101087092         CDS       T02385                                 
Symbol
MYD88
Name
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05143  African trypanosomiasis
fca05144  Malaria
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101087092 (MYD88)
   04064 NF-kappa B signaling pathway
    101087092 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101087092 (MYD88)
   04621 NOD-like receptor signaling pathway
    101087092 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101087092 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101087092 (MYD88)
   05161 Hepatitis B
    101087092 (MYD88)
   05171 Coronavirus disease - COVID-19
    101087092 (MYD88)
   05164 Influenza A
    101087092 (MYD88)
   05162 Measles
    101087092 (MYD88)
   05168 Herpes simplex virus 1 infection
    101087092 (MYD88)
   05169 Epstein-Barr virus infection
    101087092 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101087092 (MYD88)
   05135 Yersinia infection
    101087092 (MYD88)
   05133 Pertussis
    101087092 (MYD88)
   05134 Legionellosis
    101087092 (MYD88)
   05152 Tuberculosis
    101087092 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    101087092 (MYD88)
   05145 Toxoplasmosis
    101087092 (MYD88)
   05140 Leishmaniasis
    101087092 (MYD88)
   05142 Chagas disease
    101087092 (MYD88)
   05143 African trypanosomiasis
    101087092 (MYD88)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101087092 (MYD88)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101087092 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 101087092
NCBI-ProteinID: XP_003992302
Ensembl: ENSFCAG00000012873
LinkDB
Position
C2:complement(154971935..154975450)
AA seq 296 aa
MAAGGSRAGSASPIPSASSLPLAALNVRVRRRLSLFLNVRTQVAADWTALAEEMGFEYLE
IRQLEAHADPMGKLLDDWQGRPGASVGRLLELLTKLGRDDVLVELGPSIEEDCQKYILKQ
QQEESEKPLQVAAVDSSDPRTSELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggccgccggaggctcccgcgcggggtccgcgtcccccatcccctcggcgtcctccctg
cctctagctgccctcaacgtgcgagtgcggcgccgcctgtcgctgttcctgaacgtgcgg
acgcaggtggcggccgactggacggcgctggctgaggagatgggcttcgagtacttggag
atccggcagctggaggcgcatgccgaccccatgggcaagctcctggacgactggcaggga
cgcccgggagcctcggtgggccgtctgctggagctgctcaccaagctgggccgcgatgac
gtgctggtggaactggggcccagcatcgaggaggattgccagaagtatattctgaaacag
cagcaggaggagtctgagaagcccttacaggtggctgctgtagatagcagtgacccacgg
acatcagagctggcgggcatcaccacgcttgatgaccccttggggcaaatgccggagcgt
tttgatgccttcatctgctactgccccagcgatatccagtttgttcaggagatgatccgg
cagctggaacagacagactatcggctgaagttgtgtgtgtctgatcgcgatgtcctccct
ggcacctgtgtctggtccatcgccagtgagctcattgagaagaggtgccgccggatggtg
gtggtggtctctgatgattacctgcaaagcaaggaatgtgacttccagaccaagtttgcg
ctcagcctctctcccggtgcccatcagaagcgactgatccccatcaagtacaaggcaatg
aagaaagagttccccagcatcctgcggttcatcactgtctgcgactacaccaacccttgc
accaagtcctggttctggacccgccttgccaaggccttgtccctgccctga

DBGET integrated database retrieval system