KEGG   Felis catus (domestic cat): 101087258
Entry
101087258         CDS       T02385                                 
Symbol
ITGB2
Name
(RefSeq) integrin beta-2
  KO
K06464  integrin beta 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04145  Phagosome
fca04390  Hippo signaling pathway
fca04514  Cell adhesion molecules
fca04610  Complement and coagulation cascades
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05144  Malaria
fca05146  Amoebiasis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05166  Human T-cell leukemia virus 1 infection
fca05323  Rheumatoid arthritis
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101087258 (ITGB2)
   04390 Hippo signaling pathway
    101087258 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101087258 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087258 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101087258 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101087258 (ITGB2)
   04613 Neutrophil extracellular trap formation
    101087258 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    101087258 (ITGB2)
   04670 Leukocyte transendothelial migration
    101087258 (ITGB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087258 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101087258 (ITGB2)
   05134 Legionellosis
    101087258 (ITGB2)
   05150 Staphylococcus aureus infection
    101087258 (ITGB2)
   05152 Tuberculosis
    101087258 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101087258 (ITGB2)
   05144 Malaria
    101087258 (ITGB2)
   05140 Leishmaniasis
    101087258 (ITGB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101087258 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101087258 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087258 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087258 (ITGB2)
   04515 Cell adhesion molecules [BR:fca04515]
    101087258 (ITGB2)
   04090 CD molecules [BR:fca04090]
    101087258 (ITGB2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101087258 (ITGB2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101087258 (ITGB2)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin beta subunits
   101087258 (ITGB2)
CD molecules [BR:fca04090]
 Proteins
  101087258 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 101087258
NCBI-ProteinID: XP_011284106
Ensembl: ENSFCAG00000002284
LinkDB
Position
C2:1762922..1788480
AA seq 770 aa
MLPQHFPLLTLVGLLALWSALGQKCTKFKVSNCRDCVESGPGCAWCQKLNFTGLGEPDSV
RCDTREQLLLKGCAADDIIDPRSLAETYDDQEGVQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLKNPCPNKEKECQAPFAFRHVLKLTNNSHQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLAESNIQPIFAVTKRMVKTYEKLTEVIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNTVPNTLRVTYDSFCSNGVSQVDQPRGDCDGVQINVPITFQVKVTATEC
IHEQSFVIRALGFTDTVTVHVLPQCECHCRDMSQNRGLCGDRGSMECGICRCDAGYIGKN
CECQTQGRSSQELEGSCRRDNNSLICSGLGDCLCGQCVCHQSDIPNKSIFGRFCECDNVN
CERYDGLVCGGKERGTCSCGKCSCNPGFEGSACQCDRSTRGCLNPDGFECNGRGRCVCNV
CECDTGYQPPLCLECLGCPSPCGRYLLCAQCLKFDPSHSGSNCTSVCGNVGLLNKPPEKG
RTCKERDVDGCWITYTLRQRVGRDSYDIYVDDSRECATGPQVAPIVGGIVAGVVLIGILL
LGIWKALTHVSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgccccagcacttcccgctcctcaccctggtgggtctgctcgccctctggtccgcc
ctcggccagaagtgtaccaagttcaaggtcagcaactgccgggactgcgtggagtcgggc
cccggctgtgcctggtgccagaagctgaacttcactgggctgggggagccagactccgtt
cgctgcgacacccgggagcagctgctattgaagggatgtgcagctgacgacatcatagac
cccaggagcctggccgagacctacgacgaccaggagggcgtccagaagcagctgtcccca
cagaaagtgacactctacctgagaccaggtcaggcggctgccttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactacctgatggacctctcctactccatgctg
gacgacctcatcaacgtcaagaagctggggggtgatctgctccgggctctcaacgaaatc
accgagtcgggccgcatcggcttcgggtccttcgtggacaagacggtgctccccttcgtg
aacacgcaccccgagaagctgaagaacccgtgccccaacaaagagaaggagtgccaggcg
ccgttcgccttcaggcacgtgctgaagctcaccaacaactcccaccagttccagaccgag
gtggggaagcagctcatttccggaaacctggacgcccccgagggcggtctggacgccatg
atgcaggtcgccgcttgcccggaggaaatcggctggcgcaatgtcactcggctgctggtg
ttcgccacggacgacggcttccactttgcgggtgacgggaagctgggcgccatcctgacc
cccaatgacggccgctgtcacctagaggacaacatgtacaaaaggagcaatgaatttgac
tacccgtcggtgggccagctggctcacaaactggctgaaagtaacatccagcccatcttc
gccgtgaccaagagaatggtgaaaacctatgagaaactcaccgaggtcatccccaagtca
gcggtgggggagctgtcagaggattccagcaacgtggtgcagctcattaagaacgcctac
aataaactctcctccagggtctttctggaccacaacactgtccccaacaccctgagagtc
acctatgactccttctgcagtaatggagtatcacaggtggaccagcccagaggggactgt
gacggagtccagatcaacgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccatgagcagtcctttgtcatccgggccctgggcttcacggacacggtgaccgttcac
gtccttccccagtgcgagtgccattgcagggacatgagccagaaccgcggcctctgtggt
gacaggggctccatggagtgcggcatctgcaggtgcgacgccggctacatcgggaagaac
tgtgaatgccagacgcagggccggagcagtcaggagctggagggcagctgccggagggac
aacaactccctcatctgctcggggctgggggactgcctgtgcgggcagtgcgtgtgccac
cagagcgacatccccaacaagagtatcttcgggcgcttctgcgagtgcgacaacgtcaac
tgcgagcgctatgatggcctggtctgcgggggcaaggagcggggcacctgttcctgcggc
aagtgctcctgcaacccgggcttcgagggctccgcgtgccagtgtgacaggtccacccgg
ggctgcctgaaccccgacggctttgagtgtaacgggcgcggccgctgtgtctgcaacgtg
tgtgagtgtgacaccggctaccagccgcccctgtgcctggagtgcctgggctgcccgtcg
ccctgcggccgctacttgttgtgcgcccagtgcctgaaatttgacccgagccactcgggg
agtaactgtacctcggtgtgcgggaacgtgggcctgctgaacaagcccccggagaagggg
cgcacgtgcaaggagcgggacgtggacggctgctggatcacctacacgctgcggcagcgg
gttggcagggacagctatgacatttacgtggatgacagccgagagtgtgcgacgggcccc
caagttgcccccatcgtggggggcatcgtggcaggggtcgtactcatcggcatcctcctg
ctgggcatctggaaggctctgacccacgtgagtgacctcagggagtacaggcgatttgag
aaggagaagctcaagtcccagtggaacaatgacaacccccttttcaagagcgccaccacg
acagtcatgaacccaaagtttgctgagagttaa

DBGET integrated database retrieval system