KEGG   Felis catus (domestic cat): 101087366
Entry
101087366         CDS       T02385                                 
Symbol
BAIAP2
Name
(RefSeq) brain-specific angiogenesis inhibitor 1-associated protein 2 isoform X2
  KO
K05627  BAI1-associated protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04520  Adherens junction
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101087366 (BAIAP2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101087366 (BAIAP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101087366 (BAIAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087366 (BAIAP2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    101087366 (BAIAP2)
SSDB
Motif
Pfam: IMD SH3_2 SH3_9 SH3_1 BAR BAR_3 Peptidase_Mx1 RasGAP OmpH
Other DBs
NCBI-GeneID: 101087366
NCBI-ProteinID: XP_003997312
Ensembl: ENSFCAG00000011461
UniProt: A0A337S118
LinkDB
Position
E1:61623586..61686337
AA seq 519 aa
MSLSRTEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSRGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGDLENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPERA
VQLMASSNGSVLPSALSASKSSLVISDPIPGAKPLPVPPELAPFVGRLSAQESAPVMNGV
SGPDGEDYSPWADRKAAQPKASSPPQSQSKLSDSYSNTLPVRKSVTPKNSYAATETKTLP
RSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTK
MRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKEELALPPPDYGTSSRAFPAQT
AGTFKQRPYSVAVPAFSQGLDDYGARAVSSGSGTLVSTV
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgtcgctgtcgcgcacggaggagatgcaccggctcacggaaaatgtctacaagaccatc
atggagcagttcaaccccagccttcggaacttcatcgccatggggaagaactacgagaaa
gccctggcaggtgtgacctatgctgctaagggctattttgatgccctcgtgaagatgggc
gagctggccagcgagagccagggctccaaagaactcggagacgttctctttcagatggct
gaagtccacaggcagattcaaaatcagttggaagaaatgctgaagtctttccacaacgag
ctgctcacacagctggagcagaaggtagagctggactccaggtacctgagcgctgcgttg
aagaaataccagacggagcaacggagcaggggcgatgcgctggacaagtgccaggccgag
ctgaagaagcttcgcaagaagagccaaggcagcaagaacccgcagaagtactcggacaag
gagctgcagtacattgacgccatcagcaacaagcagggcgacctggagaactacgtgtcg
gacggctacaagaccgcgctcaccgaggagagaaggaggttctgcttcctggtggagaag
cagtgtgccgtggccaagaactccgccgcctaccactccaagggcaaggagctgctggca
cagaagctgcctctgtggcaacaggcctgcgccgaccccaacaagatcccggagcgcgcg
gtgcagctgatggccagcagcaacggctccgtcctccccagcgccttgtcggcctccaag
tccagcctggtcatctcagaccccattccgggggccaagcctctgccggtgccccctgag
ctggccccgtttgtggggcggctgtccgcccaggagagcgcgcccgtcatgaacggcgtc
tcgggccctgatggcgaggactacagcccctgggccgaccgcaaggccgcccagcctaag
gcctcgtccccaccacagtcacagagcaagctgagcgactcctactccaacacgctcccc
gtgcgcaagagcgtgactccgaaaaacagctacgctgccactgagaccaagaccctgccc
cgctccagctccatggcagccggcctggagcgcaatggccgcatgcgagtgaaagccatc
ttctcccacgcggccggggacaacagcaccctgctgagcttcaaggagggcgacctcatc
accctgctagtgcccgaggcccgtgacggctggcactacggggagagcgagaagacaaaa
atgcggggctggtttccgttctcctacacccgggttctggacagcgacggcagcgacagg
ttgcacatgagcctgcagcagggaaagagcagcagcacgggcaacctcctggacaaggag
gagctggcactgccaccgcccgactacggcacgtcctcgcgtgccttccctgcccagacg
gccggcaccttcaagcagaggccctacagcgtggccgtgcctgccttctcccagggtcta
gacgactacggagcccgggctgtgagcagcggcagcggcacgctggtgtccacagtgtga

DBGET integrated database retrieval system