KEGG   Felis catus (domestic cat): 101087372
Entry
101087372         CDS       T02385                                 
Symbol
CIITA
Name
(RefSeq) MHC class II transactivator isoform X1
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04612  Antigen processing and presentation
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05164  Influenza A
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101087372 (CIITA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101087372 (CIITA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101087372 (CIITA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101087372 (CIITA)
  09163 Immune disease
   05340 Primary immunodeficiency
    101087372 (CIITA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101087372 (CIITA)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101087372 (CIITA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101087372 (CIITA)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  TAF1 family
   101087372 (CIITA)
Pattern recognition receptors [BR:fca04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101087372 (CIITA)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_4 LRR_8 LRR_9 CARD
Other DBs
NCBI-GeneID: 101087372
NCBI-ProteinID: XP_011288873
Ensembl: ENSFCAG00000028848
LinkDB
Position
E3:complement(35581267..35627979)
AA seq 1204 aa
MNHFQTILPRVRMLLAGHLPSQARALLDSMLERELLSREYHCALLREPDGEALARKISLT
LLEKGDPGLALLRWAWGTWQAPLAERDPDDKDRAGSGQCAAMELGPLEGGYLELLNSNAD
PLQLYHLYDQMDPAREEIELCSEPDMDTINCEQFSRLLCDMEGDEETREAYANIAELDQY
VFQDSQMEGLSKGIFIEHIGLEEMIGESVETLEEKKSQKRSFPEELPMDSKHRKLAEPLA
VPMVTGTFLVGSVSDSSALPCLSPPAVFNKEPASSQRWLEETILMPVPPSSSLLSCLSLS
AGHIQIVPTLPQGLWQISGAGTGVSGMVIYQGEVPQASQVLPSSSPAIHSLPKSPERPGS
TSPFAPSAADLPGMPEPALTSRADVTEEQMSPTRSPAAHGVSGQLPKWPERVEKFCSALR
DMYQAEPAGPEGILVEVDLVRARLERSSSKSQERELATPDWAERQPARGGLAEVLLAGGD
RRRPRETQVIAVLGKAGQGKSRWAREASRAWARGQLPQYDFVFYLPCHCLDRGGDTYRLQ
DLLFSLGPRPLPVDDEVFSYVWRRPDRVLLILDASEGLEGQDGLLHSACGPVCTEPHSVR
GLLAGLFQRKLLRGCTLLLTARPRGRLAQSLSKADALFEVAGFSAEQAKTYLTRYLERAG
ATERQERALELLQGQPFLLSHCHSPTLCRAVGQLSEALLELGGETELPSTLTGLYVGLLG
PAARDSPPGALAGLARLAWELGRRRRGTLLESQFPSAEARAWAVAKGLVQPAPGAAAVGL
AFCSFLLQCFLGAVWLALSSDIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLVFQPH
ADCLGALAGPAAATLKDRKQKVLTRYLKRLQPGTLRAGQLLELLHCTRETLDAGLWQHVV
QGLPARLSFVGTRLTPPHTYVLGSALEAAGRDFSLDLCSTGIDPPGLGSLVGLSCVTHFR
AALSDMVGLWESLQQRGEAKLLRAVEEKFTIEPFKAKSVKDVEDLGNLVQIQRTRSSSED
TAGELPAVRDLKKLEFALGPVSGPQAFPKLVRILEAFSSLQHLDLDSLSENKIGDEGVEQ
LSATFPRLKALETLNLSQNNITDVGACKLAEALPSLAESLLRLSLYNNCICDMGAESLAH
VLPDMGSLRVLDVQYNKFTAAGAQQLAASLRKCPHVETLAMWTPTIPFGVHEHLQQLDAR
ISLK
NT seq 3615 nt   +upstreamnt  +downstreamnt
atgaaccacttccagaccatcctgcctcgggtccggatgctgctggctggccatctgccg
agccaggcccgggccctcctggacagcatgttggagagggagctcctctccagggagtac
cactgcgctctgctccgcgagcctgacggcgaggccctggccaggaagatctccttgacc
ctgctggagaaaggagacccaggcttggccctcttgaggtgggcatggggtacgtggcag
gccccgctggccgagagggaccccgacgacaaggaccgtgccggcagtgggcagtgtgcc
gccatggagttggggcctctagaaggcggctacctggagcttctcaacagcaatgctgac
cccctgcagctctaccacctctatgaccagatggacccggctagagaagagattgagctc
tgctcagaacccgacatggacaccatcaactgcgagcagttcagcagactgttgtgtgac
atggaaggtgatgaagagaccagggaggcttatgccaatatcgcggaactggaccagtac
gtgttccaggactcacaaatggagggtctgagcaaaggcattttcatcgagcatatagga
ttggaagaaatgatcggcgagagtgtggagacgctggaggaaaagaaaagtcagaaaaga
tccttcccagaggagctgcccatggactcgaagcacaggaagctggctgagcccctcgct
gtgcccatggtgactggcactttcctggtggggtccgtgagtgactcctcagctctgccc
tgcctgtcaccccctgctgtgttcaacaaggagccagcatccagccagaggtggctggag
gagaccatcctgatgcctgtgcccccttccagttccttgctgagctgcctgagcctttct
gctggacacatccagatcgtccccactctgccccaggggctctggcaaatctcaggggct
gggacaggggtatctggtatggtcatctatcaaggtgaggtgccccaggccagccaggtg
cttccttccagcagccccgccatacacagcctccccaaatccccagaacggcccggctcc
accagcccctttgccccgtctgccgctgacctccccggaatgccggaaccagctctgacc
tcccgtgcagatgtgacagaggagcagatgtcccctacccgatccccggcagctcacggg
gtctccggccagctcccaaaatggcctgagcgggtggagaagttctgcagcgcccttcgg
gacatgtaccaggctgagcccgcaggcccggaaggcatcctggtggaggtggacctggtg
agggcgcggctggaaaggagcagcagcaaaagccaggagagggagctggccaccccggac
tgggcagagcggcagccggcccgcgggggcctggccgaggtgctgctggcggggggtgac
cgccggcggccgcgggagacgcaggtgatcgctgtgctgggtaaagcggggcaggggaag
agtcgctgggcccgggaagcgagccgggcctgggcccgcggccagctgccccagtacgac
ttcgtcttctacctcccctgccactgtttggaccgtgggggggacacctaccgcctgcag
gatctgctgttctccctgggcccccggccgctgccggtggacgatgaggtcttcagctac
gtctggaggaggcccgaccgggttctgctcatcctggatgcctccgagggcctcgaaggc
caagacggcctcctgcacagcgcgtgtggacccgtgtgcacagagccccactccgtccgg
ggactgctggcgggcctcttccagcgtaagctgctgcggggctgtaccctgctgctcacg
gcccggccccggggccgcctggcccagagcctgagcaaggccgacgctctgttcgaggtg
gccggcttctcagccgagcaggccaagacctacctgacgcgctacctggagcgcgcaggg
gcgaccgagcgccaagagagagccctggaactcctccagggccagcctttcctcctcagc
cactgccacagccccactttgtgccgggccgtgggccagctgtccgaggccctcctggag
ctggggggcgagacggagctgccctccacgctcacgggactctacgtgggcctgctcggc
cctgccgcccgcgacagccccccgggggccctggcgggactggccaggctggcctgggag
ctgggccgcagacgccggggcaccttgctggagagccagttcccgtcggcggaggcgagg
gcctgggccgtggccaagggcttggtgcagcccgccccaggggccgcggcggtggggctg
gccttctgcagcttccttctgcagtgcttcctgggggccgtgtggctggccctgagcagc
gacatcaaggacaaggagctgccacagtacttggcgttgaccccgaggaagaagaggccc
tacgacaactggctggagggcgtgccgcggttcctggcggggctggttttccagccgcac
gccgactgcctcggggccctggcggggcctgctgcggccaccctgaaggacaggaagcag
aaagtgctcaccaggtacctgaagcggctgcagccggggacgctgcgggccggacagctg
ctggagctgctgcactgcacccgtgagactttggacgctgggctctggcagcacgtggtg
caggggctccccgcccgcctctccttcgtgggcacccggctcacgcctccccacacctat
gtcctgggcagcgccttggaggcggcgggccgagacttctccctggacctctgcagcact
ggcattgacccccctggactggggagcctcgtgggactcagctgcgtcacccatttcagg
gctgcgctgagtgacatggtggggctgtgggagtctctacagcagcgtggggaggccaag
ctgctccgggcggtggaggagaagttcaccatcgagcctttcaaggccaagtccgtgaag
gatgtggaagatctgggcaacctcgtgcagatccagaggacaagaagttcttcagaagat
acggctggagaactccctgcggtccgggatctaaagaagctagagttcgcgctgggcccc
gtctcaggcccccaggcttttcccaagctggtgaggatcctcgaggccttttcctccctt
cagcatctggacctggactctctgagcgagaacaagattggcgacgagggtgtcgagcag
ctgtcggccaccttcccgcggctcaaggccctggagaccctcaacttgtcccagaacaac
atcaccgatgtgggcgcctgcaagctcgccgaggccctgccctcgctggctgagtccctc
ctcaggctcagcttatataataactgcatctgtgacatgggagccgagagcctggcgcac
gtgcttccagacatggggtccctccgggtgctggatgtccagtataacaagttcacagcc
gccggggcccagcagctggccgccagcctgagaaagtgccctcacgtggagacgctggcg
atgtggacgcccaccatcccgtttggcgtccacgagcacctacagcagctggatgcgcgg
atcagcctgaagtga

DBGET integrated database retrieval system