KEGG   Felis catus (domestic cat): 101087384
Entry
101087384         CDS       T02385                                 
Symbol
CALR
Name
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04145  Phagosome
fca04612  Antigen processing and presentation
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101087384 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087384 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101087384 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101087384 (CALR)
   05170 Human immunodeficiency virus 1 infection
    101087384 (CALR)
   05168 Herpes simplex virus 1 infection
    101087384 (CALR)
   05163 Human cytomegalovirus infection
    101087384 (CALR)
   05169 Epstein-Barr virus infection
    101087384 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101087384 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101087384 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101087384 (CALR)
Chaperones and folding catalysts [BR:fca03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   101087384 (CALR)
Lectins [BR:fca04091]
 Calnexin / calreticulin
  101087384 (CALR)
SSDB
Motif
Pfam: Calreticulin MDM10
Other DBs
NCBI-GeneID: 101087384
NCBI-ProteinID: XP_003981971
Ensembl: ENSFCAG00000000479
LinkDB
Position
A2:9208663..9212568
AA seq 417 aa
MLLPVPLLLGLLGLAAAEPTVYFKEQFLDGDGWTDRWIESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPEGLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEADKEDEEDKDEDEEDEDEKEEEEEEDAATGQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctgctacccgtgccgttgctgctcggcctcctcggcctggccgccgccgagcccacc
gtctacttcaaggagcagtttctggacggagacgggtggaccgaccgctggattgaatcc
aaacacaagtcagattttggtaaatttgttctgagttccggcaagttctacggtgaccag
gaaaaggataaagggctgcagacaagccaggatgcccgcttttatgccttgtcggccaga
tttgagccctttagcaacaagggccagacgctggtggtgcagttcacagtaaaacacgag
cagaacatcgactgtgggggcggctacgtgaagctatttccagagggcttggaccagacg
gacatgcacggagactctgaatacaacatcatgtttggcccggatatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggac
attcgttgcaaggatgatgaattcacacacctgtatacgctgattgtgcggccggataac
acctatgaggtgaagatcgacaacagccaggtggagtcaggctccttggaggatgattgg
gacttcttgcctcccaagaagataaaggatcctgatgctgcgaagcctgaagactgggac
gagcgggccaagattgatgaccccacagactccaagcctgaggactgggacaaacccgag
cacattcctgaccctgatgctaaaaagccggaggactgggatgaagagatggacggagag
tgggaaccaccagtgattcagaaccctgagtacaagggcgagtggaagccccggcagatc
gacaacccagattacaagggcacttggatccacccagagattgacaaccctgagtactcc
cctgatagcaacatctatgcctatgaaaactttgctgtcctgggcttagatctctggcag
gtcaagtctggcaccatttttgacaacttcctcatcaccaacgacgaggcgtacgcagag
gagtttggaaacgagacctggggtgtcacgaaggcggcggaaaagcagatgaaggacaag
caagatgaggaacagagactaaaggaggaagaggaggacaagaagcgtaaggaagaggag
gaggcagacaaggaagacgaggaagacaaggatgaggatgaggaggacgaggatgagaag
gaggaggaggaggaggaagatgctgccactggccaggccaaggacgagctgtag

DBGET integrated database retrieval system