KEGG   Felis catus (domestic cat): 101087567
Entry
101087567         CDS       T02385                                 
Symbol
SMO
Name
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
fca  Felis catus (domestic cat)
Pathway
fca04340  Hedgehog signaling pathway
fca04360  Axon guidance
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101087567 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    101087567 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087567 (SMO)
   05205 Proteoglycans in cancer
    101087567 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    101087567 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101087567 (SMO)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101087567 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 101087567
NCBI-ProteinID: XP_011278860
LinkDB
Position
A2:147172893..147194389
AA seq 793 aa
MAAARLALGPGILLLGRLLLLLLLGGPGRGAALSGNATGPGPRSAGGSARRSAAVTGPPP
LLSHCGRAAPCEPLRYNVCLGSALPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCW
AVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCP
NEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGA
VTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADG
TMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSY
FHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFL
IRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAE
WERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTK
ATLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGP
VAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEKANLWLVEA
EISPELEKRLGRKKKRRKRKKEVCLLVPPPELHHPAPAPAPAASAVPRLPQLPRQKCLVA
AGAWGAGESCRQRAWTLVSNPFCPEPSHLQDPFLPSAPVPTAAWAQGCRQGLGPIHSRTN
LMEAELMDADSDF
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggccgctgcccgcctcgcactggggccagggatcctgctcctggggcggctgctgctg
ctgctgctgctggggggcccaggccggggggcggccttgagcgggaacgcgactgggcct
gggccgcggagcgcgggcgggagcgcgagaaggagcgcggccgtgaccggccctccgccg
ctgctgagccactgcggccgggcagccccctgcgagccgctacgctacaacgtgtgcctg
ggctcggcgctgccctacggggccacctccactctgctggccggggactcggactcccag
gaagaagcgcacggcaagctcgtgctctggtcgggcctccggaacgccccccgctgctgg
gcagtgatccagcccctgctgtgtgctgtgtacatgcccaaatgcgagaatgaccgggtg
gagctgcccagccgcaccctgtgccaggctacccgaggcccctgtgccattgtggagagg
gagcgtggctggcctgacttcctgcgctgtacccctgaccacttccccgagggctgcccg
aatgaggtgcagaacatcaagttcaacagttcgggccagtgtgaggctcccttggttcgg
accgacaaccccaagagctggtatgaggacgtggagggatgtgggatccagtgccagaac
ccgctgttcactgaggccgagcaccaggacatgcacagctacatcgcggccttcggcgca
gtcacaggcctctgcacgctcttcaccttggccacatttgtggctgactggcggaattcg
aatcgctaccctgctgttattctcttctacgtcaatgcgtgtttctttgtggggagcatc
ggctggttggcccagttcatggacggcgcccgccgggagatcgtctgccgtgcagatgga
accatgaggctcggggagcccacctccaatgagaccctgtcctgcgtcatcatctttgtc
atcgtgtactacgcccttatggctggtgtcgtctggtttgtggtcctcacctatgcctgg
cacacctccttcaaagccctgggcaccacctatcagcctctctccggcaagacctcctac
ttccacctgctcacgtggtcactcccgtttgtcctcactgtggcaatccttgccgtcgcc
caggtggatggggactctgtgagcggcatctgttttgtgggttacaagaactaccgatac
cgtgcaggcttcgtgctggccccaattggcctggtgctcattgtgggaggctacttcctc
atccgaggagtcatgactctgttttccatcaagagcaaccatcccgggttgctgagtgag
aaggctgccagcaagatcaacgagaccatgctgcgcctcggcatttttggcttcctggcc
tttggctttgtgctcatcaccttcagctgtcacttctacgacttcttcaaccaggctgag
tgggagcgcagcttccgggactatgtgctgtgccaggccaacgtgaccatcgggctgccc
accaagaagcccattcctgactgtgaaatcaagaatcgccccagcctcctggtggagaag
atcaacttgtttgccatgtttggaaccggcattgccatgagcacctgggtctggaccaag
gccacgctgctcatctggaggcgcacctggtgcaggttgactgggcagagtgatgatgag
cccaaacgcatcaagaagagcaagatgatcgccaaggccttctccaagcggcgtgagctg
ctgcagaacccaggccaggaactctccttcagcatgcacactgtctcccacgacgggcct
gtggcgggtttggcctttgacctcaatgagccctctgccgatgtgtcctctgcctgggcc
cagcatgtcaccaagatggtggctcggagaggggccatactgccccaggatgtgtctgtc
acccctgtggcaactccagtgcccccagaggaaaaagccaacctgtggctggttgaggca
gagatctccccagagctggagaagcgcctgggccggaagaagaagcggaggaagaggaag
aaggaggtgtgcctgctggtgccacctccagagcttcaccaccctgcccctgcccctgcc
cctgcggccagtgctgttcctcgactgcctcagctgccccggcagaagtgcctggtggcc
gcaggtgcctggggagctggggaatcctgccgacagagagcctggaccctggtctccaac
cctttctgcccagagcccagtcacctgcaggatccatttctgcccagtgccccagttccc
acggcggcctgggctcagggctgccggcaggggctggggcccattcactcccgcaccaac
ctgatggaggcagagctcatggatgcagattcagacttctga

DBGET integrated database retrieval system