KEGG   Felis catus (domestic cat): 101087601
Entry
101087601         CDS       T02385                                 
Symbol
IL10RA
Name
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101087601 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101087601 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101087601 (IL10RA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101087601 (IL10RA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101087601 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101087601 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101087601 (IL10RA)
   04090 CD molecules [BR:fca04090]
    101087601 (IL10RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101087601 (IL10RA)
CD molecules [BR:fca04090]
 Proteins
  101087601 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101087601
NCBI-ProteinID: XP_003992449
Ensembl: ENSFCAG00000011763
UniProt: M3WFQ1
LinkDB
Position
D1:15647656..15659651
AA seq 578 aa
MLPRLVVPLAVLLSLRLCSGAHGTELPSPPSVWFEAEFFSHILHWTPIPNQSESTYYEVE
LLRYGRDSWESTPSCNQTLVLSCDLTIMTLDLYHDNSYKARVRAMAGNRYSNWTNTNTRF
SLDEVTLMVSVKLQVDNGIILGRIQLPRPGIAPTGDTYESIFQHFREYEIKLRKVPGNST
FIKQKINRETFSLSPPGELGEFCVKVKPSVASRVNRGLWSKEECIVLTPQYFTVTNLIIF
FTFVLLLCGALAYCLALQLYVRRQRKLPTVLVFGKPHPFNLVLQLSCPEPQDTIHPLDEG
AFPKVSPELKNSELHGSTDSGFGSAKSSLQNEGSQFLLPVPHPQAAGTVGKGAPREPENS
RSGGSSNSTDSGICLQEPSPSPGTGPHWEQRVRKSSQGQDDSGLGLAQNSEGQPGDVQGV
SDLGRVNPPGPEVPGEEDPASVAFRGYLKQTRCTQERATTAGCLEEEPASTDGLGPKFRT
CLDAEADWPPLALAKGYLKQDPGTTRPASGTPTGQWSRPTEEWSLLGLTSSRDLGASDCN
LAHDLAPLDCMAAPGGLLDRFDSNLVTLPLISSLHSNE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgctgccgcgcctggtagtgccgctggcggtgctcctcagcctgcgcctctgctccggc
gcgcacggaacagaacttcccagccctccatctgtgtggtttgaagcagaatttttctcc
catatcctccactggactcccatcccgaatcagtcagaaagcacctactatgaagtggag
cttctgaggtatggaagagactcctgggagtccacccccagctgtaaccagaccctggtg
ctgtcctgtgatctcactattatgaccctggacctgtaccacgacaatagctacaaagcc
agggtccgggcaatggctggaaaccggtactccaactggaccaacaccaacacccgcttc
tccctggatgaagtgactctgatggtcagcgtgaagctacaggtggacaacggcatcatc
ctcgggcggatccagctccccaggcccgggatcgcccctacaggcgacacttacgaaagc
atcttccaacacttccgagagtatgagattaagctgcgcaaggtgccggggaactctacg
ttcataaagcagaagataaaccgtgaaaccttcagcctctcacctcctggagaactggga
gaattctgtgtcaaggtgaagccatctgtggcctcccgagtgaacagggggctgtggtcc
aaggaagagtgcattgtgcttaccccacagtatttcaccgtgaccaacctcatcatcttc
ttcaccttcgtcctgctgctctgcggagccctggcctactgcctggccctccagctgtac
gtgcgacgccagaggaagctgcctaccgtcctggtcttcgggaagccccatccgttcaac
ttggtcctccagctctcctgcccagagccccaggacaccatccatccccttgacgagggg
gccttccccaaagtgtccccggagctgaagaactcggaactgcacggcagcacggacagc
ggctttggcagtgcgaagtcatccctgcagaatgaggggtcccagttcctcctgccggtc
ccccacccccaggcggcggggactgtgggaaagggggcgccccgagagccggagaacagc
cgcagcgggggcagcagcaacagcacagacagcgggatctgcttgcaggagcccagcccg
agtcctggcaccggaccccactgggagcagcgggtgaggaagagcagccagggccaggac
gacagcggcctcggtctagcccaaaactcagaagggcagcctggggatgtgcagggggtc
tcagacttgggccgtgtcaatcccccagggcctgaggtgcctggggaggaagacccagcc
tcagtggcattccggggctacctaaagcagaccagatgcacacaggagagagcaaccacg
gcaggctgcctggaggaagagcctgcctcgacagatggcctcggccccaagttcaggaca
tgcctggatgccgaggctgactggcccccgctggccctggccaagggctatttgaaacag
gacccaggaacgactcgccctgcatcagggaccccaaccggacagtggagtcggccaact
gaggagtggtcacttctgggtttgaccagctccagggacctaggagcatctgactgcaac
ttggcccatgacctggcccctctggactgtatggcagccccaggtggtctcctggaccga
tttgactcaaacctggtcactctgcctctgatctccagcctgcactcgaatgagtga

DBGET integrated database retrieval system