KEGG   Felis catus (domestic cat): 101087945
Entry
101087945         CDS       T02385                                 
Symbol
SELPLG
Name
(RefSeq) P-selectin glycoprotein ligand 1
  KO
K06544  selectin P ligand
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04613  Neutrophil extracellular trap formation
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101087945 (SELPLG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101087945 (SELPLG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101087945 (SELPLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101087945 (SELPLG)
CD molecules [BR:fca04090]
 Proteins
  101087945 (SELPLG)
SSDB
Motif
Pfam: DUF4689 Cadherin_C_2
Other DBs
NCBI-GeneID: 101087945
NCBI-ProteinID: XP_006938721
LinkDB
Position
D3:complement(17930778..17944487)
AA seq 590 aa
MQPWCARRGQMSESGWRNKISMSCSDGLCHLAPQRSYRLELKGPPVHLEMTLEGMTASYL
QTSGRPLKVGRVWDHSPGCHSRALAVWARSLSLRQRSGFSPAHEAAVPCSAEQGAMPLQV
LLLLILLGSDSSLQLRETWENGTIEAPDPLLVQGQKQVEEDPEQDMYDYIGTDPPETLFT
NSPGPVSLTWTFLAKTATLGQKDSGTPEQATLVIARGDSVGLDATGMAMGDLSMEVATQG
VPVTLGPLSKEQVTALPPITEASSTEGAPSTELATIEALSTGPAATEAQTTHPAATEAPS
TGPAATEALTTQPAATEALSTGPAATEALTTQPAATEALSTGPAATEALTTQPVATEALS
TGPAATEALTTQPVATEAPSTGPAATEAQTTQTVATEAPSAGPEATDALSTSTEPTATEV
LSTDPATTKVPSTGPATTRSLTMALLVPSDPYNSTTVAVGNSSDGFIKQWKNNQNLAPQS
SVAPSPTEALDRIPVKQCLLAILVLALVATIFLVCTVVLAVRLSRKNHMYPVRNYSPTEM
VCISSLLPEGGEAPSATANGDLPNAKSQGLKAGPREGRDGDDLTLQSFLP
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcagccttggtgtgccagacgtggccaaatgagcgagtccggatggagaaataaaata
agcatgtcttgctctgatggactttgccatctagctcctcagagaagttaccgattggag
ctaaaaggaccacctgtgcatctagagatgactctggaaggaatgactgcatcgtatttg
caaacctcaggaaggccgttgaaggttggcagggtctgggaccacagccccgggtgccac
agccgtgccctggcagtgtgggctcggtccctgtcactgaggcagagaagcggcttctcc
ccggctcacgaggcagctgtcccatgctctgctgagcagggtgccatgcctctgcaagtc
ctcctgcttctgattttgctgggctctgacagcagcctgcagctgcgggagacatgggag
aatggaaccattgaggccccggaccccctgcttgtgcagggccagaaacaagtggaggag
gacccagaacaggacatgtatgactatattggcacggaccctccagagacgctttttaca
aatagccctgggcctgtgtccctgacctggacatttctggctaagacggcaacattgggg
cagaaggattccggaactcctgaacaagccactctggtgatagccagaggggactccgtt
ggcctggacgcaacagggatggccatgggggatctgagcatggaagtggccacgcagggg
gttcccgtcacgctgggccctctgagcaaagaacaggtcactgcgttacctcccatcaca
gaggcttcatccacagagggggctccatccacagagctggccaccattgaggccctgtcc
acggggccggcagccacagaggcacagaccacacatcctgcggccacagaggccccgtcc
acggggccggcagccacagaggccctgaccacacaacctgcggccacagaggccctgtcc
acggggccggcagccacagaggcactgaccacacaacctgcggccacagaggccctgtcc
acagggccggcagccacagaggccctgaccacacaacctgtggccacagaggccctgtcc
acggggccggcagccacagaggcactgaccacacaacctgtggccacagaggccccgtcc
acggggccggcagccacagaggcacagaccacacaaactgtggccacagaggccccatcc
gcgggaccagaagccacggatgccctgtccacatccacggagcccactgccacagaggtc
ctgtccacagatcccgccaccacaaaggtcccatccacaggtcctgcgaccacaaggagc
ctaaccatggccctgcttgtgccctctgatccttacaacagcaccaccgtggcagtaggc
aattcatctgatggcttcatcaaacaatggaaaaataatcagaatcttgccccccagagc
tccgtggcccccagccccacagaggctctggaccgcatccctgtgaagcagtgcctgctg
gccatcctcgtcctggccctggtggccactatcttcctcgtgtgcacagtggtgctggct
gtccgcctctctcgcaagaatcacatgtaccctgtgcgcaattattcccccactgagatg
gtctgcatctcgtccctgctgcctgaggggggcgaagcgccctcggccacggccaacggg
gacctgcccaatgccaagagccagggcctaaaggcagggccgagggagggccgagatggg
gatgacctcaccttgcagagtttcctcccttaa

DBGET integrated database retrieval system