KEGG   Felis catus (domestic cat): 101087957
Entry
101087957         CDS       T02385                                 
Name
(RefSeq) integrin alpha-M isoform X4
  KO
K06461  integrin alpha M
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04610  Complement and coagulation cascades
fca04613  Neutrophil extracellular trap formation
fca04640  Hematopoietic cell lineage
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05146  Amoebiasis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05202  Transcriptional misregulation in cancer
fca05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101087957
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101087957
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101087957
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101087957
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101087957
   04610 Complement and coagulation cascades
    101087957
   04613 Neutrophil extracellular trap formation
    101087957
   04670 Leukocyte transendothelial migration
    101087957
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101087957
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101087957
  09171 Infectious disease: bacterial
   05133 Pertussis
    101087957
   05134 Legionellosis
    101087957
   05150 Staphylococcus aureus infection
    101087957
   05152 Tuberculosis
    101087957
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101087957
   05140 Leishmaniasis
    101087957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087957
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101087957
   04515 Cell adhesion molecules [BR:fca04515]
    101087957
   04090 CD molecules [BR:fca04090]
    101087957
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101087957
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    101087957
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101087957
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101087957
CD molecules [BR:fca04090]
 Proteins
  101087957
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   101087957
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 101087957
NCBI-ProteinID: XP_003998680
Ensembl: ENSFCAG00000005205
UniProt: A0A5F5XIV2
LinkDB
Position
E3:complement(20273792..20315252)
AA seq 1152 aa
MTHRVLLLTALALLCHGFNLDTKHATLFQENAAGFGQSVVQLEGSRLVVGAPQEIKAANQ
TGGLYQCDYSTGKCEPISLEVPLEAVNMSLGLSLAFATNPFRLLACGPTVHQTCKENTYV
NGLCFLFGSNLRQQPQRFPESLRECPRQDSDIAFLIDGSGSIIQSDFQKMKDFVSTVMGQ
FKNSKTLFSLMQYSEDFQTHFTFNEFKKSPNPSLLVRPIEQLRGRTHTATGIRKVVRELF
QSSSGAREKAFKILVVITDGEKFGDPLEYKDVIPEADKEGIIRYVIGVGAAFNSPKTREE
LNTIASKPSRDYVFRVNNFEALKTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSAAI
TSNDLLLGAVGSFDWAGGAFLYVSKDKFTFINTTRVDSDMNDAYLGYAAEVIWRSRVQNL
VLGAPRYQHTGLVVMFRENAGTWETNTVIKGSQIGSYFGASLCSVDMDKDGSSDLVLIGA
PHYYEPTRGGQVSVCPLPRGRARWQCETVLHGVQGHPWGRFGAALTALGDVNGDKLTDVA
IGAPGEQENRGAVYLFHGTSRPGISPSHSQRIEGSQLSPTLQYFGQSLSGGQDLTMDGLV
DLAIGAQGHVLLLRSQPVLRLEVTMEFTPKEVARNVFECLAKVVKGQTAGEVRVCLRVRK
NTRDRLREGEIQSNITYDLALEPTLPHPRVVFDETKNSTRRQTRILRLNQECETLKLLLP
YCVEDSVNPIILHFNFSLVGKPLSLFGNLQPVLAVDAQRLFTASFPFEQNCGSDNICHDD
LSITFTFMGLDTLVVGGPRDLNVTLTVRNQGEDSYRTQVTFFYPPGLSYRRMSVTQKQRS
QRPWRLTCESEDSTNGPEALKNSSCNISHPIFPNYSEITFNITFGVESDAFFGNRLLLKA
NVTSENNTTKTNKTEFQLELPVKYTVFVVVTSHEVSTKYLSFIASEKTSHSIKHQYEVNN
LGQRSLPIIVVFWVPIKLNQVAVWDNLQVTLSQNLSRTCNTTENSPPLSDFMAELKRAPV
VNCSIAVCQRIQCDIPSFSIQEKVNITLQGKLSFDWYIKTSANYLQVVTTAEVLYDDSKF
ALLPGQEAFLRAQIETKVEPNEVHNPVPLIVGSSVGGLVLLALITAGLYKLGFFKRQYKD
MMSEAGPNAQPQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgactcacagagttcttctgttaacagccttggccttattatgtcatgggttcaacctg
gatactaagcatgcaacgctattccaagagaatgcagcgggcttcgggcaaagtgtggtc
cagcttgagggatcccggttggtggttggagccccccaggagataaaggctgccaaccaa
acaggtggcctctaccagtgtgactacagcacgggcaagtgtgagcctatctccctggag
gtccccctggaggcggtgaacatgtctctgggcctgtctctggcatttgccaccaaccct
tttcgactgctggcctgtggtcccactgtgcaccaaacttgtaaggagaacacctatgtg
aatggcttatgcttcctgtttggatccaacctacggcagcagccccagagattcccagag
agcctcagagagtgccctcggcaagacagtgatattgccttcttgattgatggttctggt
agcatcatccagagtgactttcagaagatgaaggattttgtctcaactgtgatgggtcaa
ttcaagaattccaaaaccttgttttctttaatgcagtactctgaagacttccagactcat
ttcacctttaatgaattcaagaaaagccctaacccatcattgctggtgaggccaatagaa
cagttgcgtgggcggacacacactgccacaggaatccgcaaagtagtaagagaattgttt
cagagcagtagtggagcccgggagaaagcctttaagatcctagtagtcatcacggatgga
gaaaagtttggcgatcccttggagtacaaggatgtcattcctgaagcagacaaagagggg
atcattcgctatgtcattggggtgggagctgctttcaacagtccaaaaactcgtgaagag
cttaataccattgcatcaaagccttctcgtgattatgtgttccgggtgaataactttgaa
gctctgaagaccattcaaaaccagcttcaggaaaagatctttgcaattgagggtactcag
acaggaagtaccagctcctttgaacatgagatgtctcaggaaggcttcagtgctgccatc
acctctaatgatctcttgctaggtgctgtgggaagctttgactgggctggtggagctttt
ctgtatgtgtcaaaggacaaattcaccttcatcaacacaaccagggtagattcagacatg
aatgatgcttacttgggttatgctgccgaagtcatatggaggagcagggtgcaaaatctg
gttcttggggcacctcgatatcagcacactggcctggtggtgatgtttagagagaatgct
ggtacctgggagaccaacactgttatcaagggtagccagattggctcctactttggggcc
tccctctgctctgtggacatggacaaagatggcagctctgacctggtccttattggggcc
ccccattactacgagccgacaagggggggccaggtgtctgtgtgccccttgcctcggggg
agggctagatggcaatgtgagactgttctccatggggtgcagggccacccctggggccgc
tttggggcagccctgacagcgctgggagatgtgaatggagacaagctgacagatgtggcc
attggggccccaggagagcaggagaaccggggtgctgtttacctatttcatggaacctca
agaccgggcattagcccttcccacagccagcggattgaaggctcccagctctcccccaca
ctacaatattttggtcagtcactgagtgggggccaggacctcacaatggatggactggtg
gacctggctataggagcccaaggccatgtactgctgcttagatcccagcctgtgctgaga
cttgaggtgaccatggagttcacacccaaagaagtggcaaggaatgtgtttgaatgtctt
gcaaaggtggtgaaaggtcagactgctggggaggttagagtttgccttcgtgtccgcaag
aatacacgggacaggctaagagaaggagagattcagagcaacatcacatatgacttggct
ctggagccaactctcccacatccccgagttgtctttgatgagacaaagaacagcacacgc
agacagacaagaatcttgaggctgaatcaagaatgtgagaccctaaagctactgttaccg
tattgtgtggaggattcagtgaaccccatcatcctgcacttcaacttctctctggtgggg
aaacccttgtccttattcgggaacctccagccagtgctggctgtggatgcacagagactc
ttcacagcttcgtttccttttgagcagaattgtggcagtgacaacatttgccatgatgac
ctcagcatcaccttcacttttatgggtctggataccctggtggtgggtggtccccgagac
ctgaatgtgacattgactgtgagaaaccagggcgaggactcctacaggactcaagttacc
ttcttctacccacctggcctgtcctataggaggatgtcagtgacccagaagcagcgctca
cagcgaccatggcgcctgacttgtgagtctgaagactccaccaatgggcccgaggctttg
aagaatagcagctgcaacataagccaccccatcttcccaaactactcagagatcaccttt
aatatcacatttggtgtggaatctgatgctttctttggaaacagactactactcaaggcc
aatgtgaccagtgagaacaacacaactaagaccaacaaaactgaattccaactggagttg
cctgtgaaatacactgtcttcgtggtggtcacaagccatgaagtctccaccaaatatctc
agcttcatagcctcagagaagaccagccacagtataaagcaccagtatgaggtcaacaac
ttgggacagaggagcctccccatcattgtggtcttctgggtgcctatcaagctgaaccag
gtggctgtgtgggacaacctccaggtcaccctttcccagaacctctccagaacatgcaac
accacggagaattctccccctctctctgacttcatggcagagcttaagagggccccagtg
gtgaactgctccattgctgtctgccagagaatccagtgtgacatcccatccttcagcatc
caggaaaaagtcaacattaccctccaaggcaaactctcatttgactggtatatcaagact
tcagcaaactaccttcaggttgtgaccacggcagaggtcttgtatgatgattcgaagttt
gccctgcttccaggacaggaggcatttctgagggcccagatagaaaccaaagtggagcca
aatgaagtgcacaaccctgtaccacttatagtgggcagctcagtgggggggctggtgctt
ctggccctcatcaccgctggactgtacaagcttggcttcttcaaacggcagtacaaggac
atgatgagtgaagctggtcccaatgcccagccccagtaa

DBGET integrated database retrieval system