KEGG   Felis catus (domestic cat): 101087962
Entry
101087962         CDS       T02385                                 
Symbol
CXCL14
Name
(RefSeq) C-X-C motif chemokine 14
  KO
K10033  C-X-C motif chemokine 14
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101087962 (CXCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101087962 (CXCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101087962 (CXCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101087962 (CXCL14)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101087962 (CXCL14)
SSDB
Motif
Pfam: IL8 DUF6355 DUF5877
Other DBs
NCBI-GeneID: 101087962
NCBI-ProteinID: XP_011280502
LinkDB
Position
A1:complement(114455813..114463990)
AA seq 177 aa
ARCREGRSGFKRGLGGRREAAETARSRERNATGTRHPPTGAAGASGAEPEARSEQRELSR
PAGRPPQSLLPRRAPPASMRVLSAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKL
EMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 534 nt   +upstreamnt  +downstreamnt
gctcgctgccgcgagggcaggagcggatttaaaagaggcctgggcgggcggagggaggct
gcggagacagcgcggagccgagagcggaacgcaaccggcaccaggcacccaccgacgggc
gcagcgggagcgagcggagcagagccggaggcgcgctccgagcagagagagctgagccgg
ccggccgggcgccctccccagtccctgctcccgcgccgcgcccctccggccagcatgagg
gtcctgtcagccgcgctactcctgctgctcctggcgctgtgcgccgcacgcgtggacggg
tccaaatgtaaatgctcccgaaaggggcccaagattcgatacagcgacgtgaagaagctg
gaaatgaagccaaagtacccacactgcgaggagaagatggttatcatcaccaccaagagc
gtgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcaccaagcgg
ttcatcaagtggtacaacgcctggaacgagaaacgcagggtctacgaagagtag

DBGET integrated database retrieval system