Felis catus (domestic cat): 101088237 Help Entry 101088237         CDS       T02385                                  Name (RefSeq) histone H2A type 1-B   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101088237  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101088237  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101088237  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101088237   09165 Substance dependence    05034 Alcoholism     101088237  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101088237   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101088237 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101088237 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101088237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101088237 NCBI-ProteinID:  XP_003985754 Ensembl:  ENSFCAG00000044530 LinkDB All DBs Position B2:3625441..3625946 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaaacagggtggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtgggccgcgtgcaccgcctgctccgcaagggcaactac tcggagcgggtcggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcaggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtcaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system