Felis catus (domestic cat): 101088440 Help Entry 101088440         CDS       T02385                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101088440    04151 PI3K-Akt signaling pathway     101088440   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101088440  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101088440  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101088440    04621 NOD-like receptor signaling pathway     101088440    04622 RIG-I-like receptor signaling pathway     101088440    04623 Cytosolic DNA-sensing pathway     101088440    04650 Natural killer cell mediated cytotoxicity     101088440  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101088440   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101088440    05161 Hepatitis B     101088440    05160 Hepatitis C     101088440    05171 Coronavirus disease - COVID-19     101088440    05164 Influenza A     101088440    05162 Measles     101088440    05168 Herpes simplex virus 1 infection     101088440    05163 Human cytomegalovirus infection     101088440    05167 Kaposi sarcoma-associated herpesvirus infection     101088440    05169 Epstein-Barr virus infection     101088440    05165 Human papillomavirus infection     101088440   09171 Infectious disease: bacterial    05152 Tuberculosis     101088440   09163 Immune disease    05320 Autoimmune thyroid disease     101088440   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101088440   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101088440  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     101088440 Cytokines and neuropeptides [BR:fca04052]  Cytokines   Interferons    101088440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon MnmE_helical Motif Other DBs NCBI-GeneID:  101088440 NCBI-ProteinID:  XP_003995570 Ensembl:  ENSFCAG00000023458 UniProt:  M3WZS7 LinkDB All DBs Position D4:complement(45677329..45677994) Genome browser AA seq 183 aa AA seqDB search MALSISVLLALVMLCSSPAYSLDCDLRPSNPETFTLLSQMERVSILSCLKDRTDFNFPQI LVAGNQLEKTQVTAVVHEMLQQIFNLFSKSDSFVAWDETLLDRFLVGLYQQLDDLETCLR EEMNMEQLPLGNENSRLAVKRYFQGISLYLKEKEYSHCAWEVVRVEIRRCLLVINKLTGT FRK NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atggctctctcaatctctgtgctgttggctctggtgatgctgtgctccagccccgcctac tctctggactgtgacctgcgtccgagcaatccagaaaccttcacacttttgagtcaaatg gagagagtctccattctgtcctgtctgaaggacaggactgacttcaactttcctcagata cttgtggctgggaaccagcttgagaagacacaagtgacagctgtcgtgcatgagatgctc cagcagatcttcaacctcttcagcaaaagcgactcctttgtggcttgggatgagacgctt ctggacagattccttgttggactttaccaacagctggatgacctggagacgtgtttgagg gaggaaatgaacatggaacagctacccctgggaaatgagaactccagactggctgtgaag agatacttccaaggaatcagtctctatcttaaagagaaagaatacagccactgtgcctgg gaggttgtcagggtagaaatcagaagatgcttgctcgtcattaacaagctcacagggaca ttcaggaaataa

DBGET integrated database retrieval system