KEGG   Felis catus (domestic cat): 101088449
Entry
101088449         CDS       T02385                                 
Name
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
fca  Felis catus (domestic cat)
Pathway
fca04217  Necroptosis
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05135  Yersinia infection
fca05164  Influenza A
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101088449
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101088449
   04623 Cytosolic DNA-sensing pathway
    101088449
   04625 C-type lectin receptor signaling pathway
    101088449
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101088449
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101088449
   05135 Yersinia infection
    101088449
   05133 Pertussis
    101088449
   05134 Legionellosis
    101088449
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088449
SSDB
Motif
Pfam: CARD PYRIN DUF6471 YqzH
Other DBs
NCBI-GeneID: 101088449
NCBI-ProteinID: XP_003998682
Ensembl: ENSFCAG00000002608
UniProt: A0A337STP2
LinkDB
Position
E3:20393616..20394877
AA seq 195 aa
MGCTRDAILDALENLTAEEFKKFKLKLLSVPLREGYGRIPRGPLLSMDAMDLTDKLVSSY
LEEYGAELTALVLRDIGMKELSERLQQITRKDQAAAPAGIQDSHLKAAKPAMHFVDQHRT
ALITRVTDVDGVLDALYGKVLTEELYQAVRAEPTNALKMRKLFSFTPAWNVTCKDLLLQA
LRDTQPYLVLDLEQS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggtgcactcgcgacgccatcctggacgcactggagaacctgactgcagaggagttc
aagaagttcaagctgaagctgctttcagtgcccctgcgcgaaggctatgggcgcatcccg
cgggggcccctgctgtccatggacgccatggacctcacagacaagctggtctcttcctat
ctggaagagtacggcgcagagctcacggcgctcgtgctgcgcgacattggcatgaaagag
ctatcagagcggctgcaacagatcacgcgcaaagaccaggcagccgcacctgctgggatc
caggattctcacctgaaggcagccaagccagcaatgcactttgtggaccagcaccggacg
gcccttatcacacgggtcacagatgtggacggggtgctggatgccctgtacggaaaggtc
ctgacagaggagctgtaccaggcagtgcgagcagagcccaccaatgcactgaagatgagg
aagctcttcagcttcactccagcctggaacgtgacctgcaaagatctgctccttcaggcc
ctgagggacacccagccctacctggtgcttgacctggagcaaagctga

DBGET integrated database retrieval system