KEGG   Felis catus (domestic cat): 101088458
Entry
101088458         CDS       T02385                                 
Symbol
IL9
Name
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca05310  Asthma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101088458 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101088458 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101088458 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101088458 (IL9)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interleukins
   101088458 (IL9)
SSDB
Motif
Pfam: Dynamin_M
Other DBs
NCBI-GeneID: 101088458
NCBI-ProteinID: XP_003980942
Ensembl: ENSFCAG00000013931
UniProt: M3WJR8
LinkDB
Position
A1:complement(114675105..114678714)
AA seq 141 aa
MLLSVVLASALLLCSVASQRCSTLSGIQDVTYLINKLQEHPPSKCDCGTNVTDCLCLPIP
SDDCTTPCFQEGLSQMTNSTVQTSFPLIFNRLKRNVKDLKSSKCQFFSCEQPCNQTATGN
VLTFLKSLQEILQKERVKGTV
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctcctgtccgtggtccttgcctctgccctccttctctgctctgtggccagccagagg
tgttcgaccttgtcagggatccaagatgtcacgtacctcattaacaaactgcaggaacat
ccaccttcaaaatgtgactgtggcaccaacgtgaccgattgtttgtgtctgcccattcct
tctgacgactgcaccacaccgtgcttccaggaagggctgtcccagatgaccaactccacg
gtgcaaacaagtttccctctgatcttcaaccgactaaaaagaaacgtcaaagacctaaag
agcagcaagtgccagtttttttcctgtgaacagccgtgtaaccaaactgcaacaggcaac
gtgctgacgttcctgaagagtctccaggaaattttacagaaagaaagggtgaaaggcaca
gtatga

DBGET integrated database retrieval system