KEGG   Felis catus (domestic cat): 101088468
Entry
101088468         CDS       T02385                                 
Name
(RefSeq) complement C3-like
  KO
K03990  complement component 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04145  Phagosome
fca04610  Complement and coagulation cascades
fca04613  Neutrophil extracellular trap formation
fca04936  Alcoholic liver disease
fca05133  Pertussis
fca05134  Legionellosis
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05203  Viral carcinogenesis
fca05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101088468
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088468
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101088468
   04613 Neutrophil extracellular trap formation
    101088468
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101088468
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101088468
   05168 Herpes simplex virus 1 infection
    101088468
   05167 Kaposi sarcoma-associated herpesvirus infection
    101088468
  09171 Infectious disease: bacterial
   05133 Pertussis
    101088468
   05134 Legionellosis
    101088468
   05150 Staphylococcus aureus infection
    101088468
   05152 Tuberculosis
    101088468
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101088468
   05142 Chagas disease
    101088468
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101088468
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101088468
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101088468
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088468
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088468
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   101088468
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101088468
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101088468
SSDB
Motif
Pfam: TED_complement A2M MG1 A2M_BRD MG4 MG2 MG3 ANATO A2M_recep SQHop_cyclase_C Prefoldin
Other DBs
NCBI-GeneID: 101088468
NCBI-ProteinID: XP_023100060
LinkDB
Position
A2:complement(4960383..5083807)
AA seq 1458 aa
MGPASGPSLLLLLLLPILPLAPGDPMFSMITPNILRLENEETVLLEAHDLENNIAVAVTV
HDFPVKKQVLSSENSALTKDNNHMSTVKIKIPASKELTSEKGKKFVTIQADFGSTVVEKV
VLVSFQSGYLFIQTDKPIYTPGSTVLYRIFTVDNDLLPVGRTIIVSIQTPDNILIKKDSL
SSQNQVGILSLSWNIPELVNTGQWKIEAHYEDAPQQVFSAEFEVKEYVLPSFEVQVEPTE
KFYYIDDPQGLEVTITARFLYGKNVDGIAFVIFGVQDGDQRISLPQSLTRVQIDDGSGEA
RLERKVLLSGVQPSGADALVGKSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTKT
SKFFKPGMPFDLMVFVTNPDGSPARNVPVETQDSRARSLTQADGVAKLIINTPNKPVPLP
ITVITRKDGILESRQATSSMLAQPYKIMGSCSNYLHLSVPRVELKPGEDLNVNIHLRIDP
TTTKQKDIYYYTYLIMNKGKLLKVGRQMRELGQDVVALPLTITEDFIPSFRLVVYYTCLN
SNGQREVVADSVWVDVKDSCVGKLVVKGGRKEERVHLPGQQMTLKIEGDRGARVGLVVVD
KGVFVLNKKNKLTQSKIWNVVEKADIGCTAGSGKDYAGVFTDAGLAFQTNTNLQTPDRTD
PECPKPATRRRRSVMLMEKRMDKVGQYPRQLRKCCEHGMRENPMKFSCQRRARFIQHEAS
CVKAFLDCCNYITQLRLNHTRSAHLGLARSDLDEDIIPEEEIISRSQFPESWLWRIEELS
EPEKDGISTKTMNIFLKDSITTWEILAVSLSNKKGICVADPYEVTVMQDFFIDLRLPYSV
VRNEQVEIRAVLYNYQDVGELKVRVTLLYNPAFCSQATARKPYQQILEIPAKSSMAVPFL
LVPLKVGLHDVEVKAAVYNRFLMDGVKKPLKVVPEGIRVNKTVAVHTLDPENRGQNGVQR
EEVHAIDLSDQVPDTDSETRILLQGTPVAQLTEDAIDAERLKNLIVIPSGCGEQNMKSMT
PTVIAVHYLDQTEQWEKLGPTKRKEALQLIEKGYSQQLAYRQDNSAYAAYLDRKPSTWLT
AYVVKVFSLASNLIAIQADVICGAVKWLILHRQNPDGVFQEDAPVMSQAMTGGYQENEEK
DVSLTAFVLIALEEAKDICKQRVNSLEKNINKAGDYIEFHYRNLRRPYSVAIAGYALARL
GRLKEDLLEKFLSTAKEKTSWEEPGKDLYNVEATSYALLALLVLKDFDSVRPIASWLNEQ
RYYEGGYGSTQATFMVFQALAQFQKDVPDHKDLNLEVSIELPSRSSAIRHTILWESASLQ
RSAETKKNEDFVVTAKGKGQGTLSVVTMYHAKLKSNHTCKKFDLRVDIRRAPEDVKRPQE
ALDTMILDICTKYLGEQDATMSILDISMMTGFSPDTGDLDLLSNGIDRYISMYELNKAFS
NKNTVTIYLDKVRLPMGI
NT seq 4377 nt   +upstreamnt  +downstreamnt
atggggcctgcctcaggccccagcctgctgctgctgctgctgcttcccatcctgcccctg
gcaccgggggaccccatgttctccatgatcacccccaacatcctgcggctggagaatgag
gagaccgtgctgctggaggcccatgacttggaaaataacattgcagtcgcggtcactgtc
cacgacttcccagtgaagaagcaagtgctatccagtgagaacagcgctctgaccaaagac
aacaaccacatgagcacggtcaaaatcaagatcccagccagcaaggaattaacatcagag
aaggggaaaaaattcgtgacgatccaggcagactttgggagcaccgtagtggagaaggtg
gtgctggtcagctttcagagcgggtacctcttcatccagacggacaagcccatctatacc
ccaggctccacggtcctctatcggatctttaccgtggacaacgacctactgcccgtgggc
cggaccattatcgtcagcatccagacccctgacaatattctcatcaagaaggactcccta
tcttctcagaaccaggttggcatcttgtccctgtcttggaacatcccggagctggtcaat
acagggcagtggaagatagaagcccactatgaagatgccccacagcaggtattctctgct
gagttcgaggtgaaggagtacgtgctgcccagttttgaggtccaagtggagcctacagag
aaattctactacattgatgacccacagggcctggaggtcaccatcacggccaggttcttg
tatgggaagaatgtggatggaatcgccttcgtcatctttggggtccaggatggtgaccag
aggatttcgctgccccagtccctcacccgtgttcagatcgatgatggcagtggggaggcc
aggctggaacgaaaggtcctgctgagcggggtgcaaccctccggagcagatgccctggtg
gggaagtcgttgtacgtgtctgtcaccgttatcctgcactcaggcagcgacatggtggag
gcagagcgcagcgggatccccatcgtgacctccccctaccagatccacttcaccaagacg
tccaagttcttcaaaccaggcatgccctttgacctcatggtgttcgtgacgaaccccgac
ggctccccggcacgcaacgtccctgtggagacccaggactcccgtgcacggtccttgacc
caggccgacggcgtggccaagctgatcatcaacacacccaacaaaccggtgcccctgccc
atcaccgtaatcactaggaaggatggtatcctggagtcacgacaggccacaagcagtatg
ctcgcccaaccctacaaaatcatgggcagctgcagtaactacctccatctgtctgtacct
cgcgtggagctcaagccaggggaagatctcaatgtgaacatccacctgcgaattgatccc
accaccaccaagcagaaggatatctactactacacctacctgatcatgaacaaagggaag
ctgttgaaggtgggtcgacagatgcgtgagctcggccaggatgtggtcgcattgcccctg
accatcactgaggacttcattccttccttccgcctggtggtttactacacctgccttaac
agcaatggccagagggaggtggtggccgattccgtgtgggtggatgtcaaggactcctgt
gtgggcaagctggtggtgaaaggtggcaggaaggaagagagggttcacctacctggccag
cagatgaccctcaagatcgagggtgacagaggagcccgagtggggctcgtggtggtggac
aagggtgtgttcgtgctgaacaagaagaataagttaactcaaagcaagatctggaacgtg
gtagagaaggctgacatcggctgcaccgcaggcagcgggaaggattatgccggcgtcttc
acggacgcagggctggccttccagaccaacacaaacctgcagaccccggataggacagat
cccgagtgccccaaaccagctacccgtcgccgccgctcggtgatgctcatggagaagagg
atggacaaagtgggtcagtacccaaggcagctgcgcaagtgctgtgaacatggcatgcgg
gagaaccccatgaagttctcgtgccagcgcagggcccggttcatccagcacgaggcctcg
tgcgtgaaggccttcctggactgttgcaactacatcacccaactgagactcaaccacacc
cgtagtgcccacctgggattggctcggagtgacttggatgaggatataatcccggaagag
gaaatcatttcccgaagccagttccctgagagctggctgtggcgcatagaggaactcagt
gaacctgagaaagatggaatctccacaaagaccatgaatatatttttgaaagactccatc
accacctgggagattctggcggtgagcttgtcgaacaagaaagggatctgcgtggctgac
ccctatgaggtcacggtgatgcaagacttcttcatcgacctgcggctaccctactctgtc
gtgcgcaatgagcaagtggagatccgagccgtgctctacaattaccaggatgttggggag
ctcaaggtgcgggtgaccctgctctacaacccagccttctgcagccaggccaccgcaagg
aaaccatatcagcagattctggaaatcccagccaagtcctcaatggctgtgccttttctc
ctcgtgcctctgaaggtcggtctacatgacgtggaggtcaaggctgcggtctacaatcgt
ttcctcatggatggtgtcaagaaacccttgaaggtcgtgcctgaagggatcagagtcaac
aaaactgtggctgttcacacactggatccagaaaaccggggccaaaacggagtgcagcga
gaggaggtccatgccatagacctcagtgaccaggtaccagacacagattcagagaccagg
atcctcctgcaagggaccccggtggctcagttgactgaggatgccatcgacgcggagcga
ctgaaaaacctcatcgtgatcccctcgggctgtggggagcagaacatgaaaagcatgacg
cccacggtcattgccgtccattacctggaccaaacggagcagtgggagaagttgggaccc
acaaagcgaaaggaagccttacagctcatcgaaaaggggtactcccagcagctggcctac
agacaggacaattcggcctatgcggcctacctggacaggaagcccagcacctggctgaca
gcctacgtggtcaaggtcttctctctggcttccaacctcattgccattcaggccgatgtc
atctgcggggcggtcaaatggctgattcttcacaggcagaatcccgatggggtcttccag
gaagatgcgcccgtaatgtcccaagcaatgactggtggctaccaggagaatgaagagaag
gatgtgtccctcacagcctttgttctcattgcattggaagaggctaaagatatttgcaag
caaagggtcaatagcctggaaaagaacatcaataaggcaggcgattatattgaattccac
tataggaacctgcggagaccatactctgtggccattgcaggctacgccctggcccgatta
ggcaggctgaaggaagatctcctcgaaaaatttctgagcacagccaaagagaagacaagt
tgggaggagcctggcaaggacctctacaacgtggaggccacatcctatgccctcttggcc
ctgctggtgctcaaagactttgactctgtacgtcccatcgccagctggctcaatgagcag
agatactacgaaggtggctacggctccacccaggccaccttcatggtgttccaggccttg
gcccaattccagaaggatgtccctgaccacaaggacctgaacctggaagtatccattgaa
ctgcccagccgcagctctgccatcaggcacactatcctctgggaatctgctagcctccag
cggtcagcagagaccaagaaaaatgaggatttcgtagtaacagctaaagggaagggacaa
ggcaccttgtcggtggtgacaatgtaccatgccaagctcaaaagcaaccacacctgcaag
aagtttgacctcagggttgatatacgacgagctcctgaagatgtcaagaggcctcaggaa
gccctggacaccatgatccttgacatctgtaccaagtacctgggagagcaggatgctacc
atgtcaatcctggatatatccatgatgactggcttttctcctgacactggtgaccttgac
ctgctgagcaacggcattgacagatacatctctatgtacgagctgaacaaggccttctca
aataagaacaccgtcaccatctacctggacaaggtaaggcttccaatggggatctga

DBGET integrated database retrieval system