KEGG   Felis catus (domestic cat): 101088572
Entry
101088572         CDS       T02385                                 
Symbol
SAP30
Name
(RefSeq) histone deacetylase complex subunit SAP30 isoform X1
  KO
K19202  histone deacetylase complex subunit SAP30
Organism
fca  Felis catus (domestic cat)
Pathway
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101088572 (SAP30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101088572 (SAP30)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     101088572 (SAP30)
SSDB
Motif
Pfam: zf-SAP30 SAP30_Sin3_bdg
Other DBs
NCBI-GeneID: 101088572
NCBI-ProteinID: XP_003984906
Ensembl: ENSFCAG00000025710
UniProt: M3WR27
LinkDB
Position
B1:complement(57296996..57302581)
AA seq 221 aa
MNGFTPEEMSRGGDAAAAVAAVVAAAAAAAASAGNGAGAGAGAEVPGAGAVSAAGPPGAA
GPGPGQLCCLREEGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLI
QSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLSTRPGLNKAQLV
EIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaacggcttcacgcccgaggagatgagccgcggcggggacgcggcagccgctgtggcc
gccgtggtcgctgccgccgccgccgccgccgcttcggcagggaacggggcaggggccggc
gccggggctgaggtgccgggtgccggggccgtctcggcggctgggcccccgggagcggca
gggcccgggcccggacagctgtgctgtctgcgggaggaaggtgagcggtgcggccgtgcg
gcaggcaacgccagcttcagcaagaggatccagaagagcatctcccagaagaaggtgaag
atcgagctggataagagcgcaaggcatctttacatttgtgattatcataaaaacttaatt
cagagtgttcgaaacagaagaaagaggaaagggagtgatgatgatggaggagattcacct
gttcaagatattgatactccagaggttgatttatatcaattacaagtaaatacacttcgg
agatacaaaagacacttcaaactgtcaaccagaccaggacttaataaagcacaacttgtt
gagatagttggttgccactttaggtctattccagtgaatgaaaaagacaccttaacatat
ttcatctactcagtgaagaatgacaagaacaaatcagatctcaaggttgatagtggtgtt
cactag

KEGG   Felis catus (domestic cat): 101096700
Entry
101096700         CDS       T02385                                 
Symbol
SAP30L
Name
(RefSeq) histone deacetylase complex subunit SAP30L
  KO
K19202  histone deacetylase complex subunit SAP30
Organism
fca  Felis catus (domestic cat)
Pathway
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101096700 (SAP30L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101096700 (SAP30L)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     101096700 (SAP30L)
SSDB
Motif
Pfam: zf-SAP30 SAP30_Sin3_bdg
Other DBs
NCBI-GeneID: 101096700
NCBI-ProteinID: XP_003981410
Ensembl: ENSFCAG00000014985
UniProt: A0A337S290
LinkDB
Position
A1:complement(195263441..195279032)
AA seq 182 aa
MNGFSTEEDSREGPPAAPAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLK
LDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRR
YKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQ
LE
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaacggctttagcacggaggaggacagccgcgaagggccccccgccgcccccgccgcc
gccccgggctacggccagagctgctgcctcatcgaggacggcgagcgctgcgtccggccc
gcgggcaacgcctccttcagcaagagggtccagaagagcatctcgcagaagaaactcaag
ctggacatcgacaagagcgtaaggcacctgtatatctgcgacttccacaaaaatttcatc
cagagtgtacgaaataaaaggaagaggaagacaagtgacgatggcggagattctcctgag
cacgacactgacattcctgaggttgacctgttccagctgcaggtgaacactctacggcgt
tataaacgacactacaaattgcagaccagaccaggcttcaataaggcccagttagcagaa
actgtcagccgacacttcaggaacatacctgtgaatgaaaaagagaccctcgcctacttc
atctacatggtgaagagtaacaagagtagactggaccagaaatcggagggcggcaagcag
cttgagtga

DBGET integrated database retrieval system