KEGG   Felis catus (domestic cat): 101088683
Entry
101088683         CDS       T02385                                 
Symbol
HSPD1
Name
(RefSeq) 60 kDa heat shock protein, mitochondrial
  KO
K04077  chaperonin GroEL
Organism
fca  Felis catus (domestic cat)
Pathway
fca03018  RNA degradation
fca04940  Type I diabetes mellitus
fca05134  Legionellosis
fca05152  Tuberculosis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101088683 (HSPD1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101088683 (HSPD1)
   05152 Tuberculosis
    101088683 (HSPD1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088683 (HSPD1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088683 (HSPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101088683 (HSPD1)
   03110 Chaperones and folding catalysts [BR:fca03110]
    101088683 (HSPD1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101088683 (HSPD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088683 (HSPD1)
Messenger RNA biogenesis [BR:fca03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     101088683 (HSPD1)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP60 / Chaperonin
   101088683 (HSPD1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    101088683 (HSPD1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088683 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   101088683 (HSPD1)
  Exosomal proteins of breast cancer cells
   101088683 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   101088683 (HSPD1)
  Exosomal proteins of bladder cancer cells
   101088683 (HSPD1)
SSDB
Motif
Pfam: Cpn60_TCP1 EAD9
Other DBs
NCBI-GeneID: 101088683
NCBI-ProteinID: XP_003991044
Ensembl: ENSFCAG00000025949
UniProt: M3WXZ4
LinkDB
Position
C1:complement(186369254..186380549)
AA seq 573 aa
MLRLPAVLRQIRPVSRALAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDITTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSITPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGGMGGMGGGMGGGMF
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcttcgattacccgcagtacttcgccaaattaggccagtgtccagggcactggctcct
catcttactcgggcctatgccaaagatgtaaaatttggtgcagatgcccgagccttaatg
cttcaaggtgtagaccttttagctgatgctgtagctgttactatggggccaaagggaaga
acagtgattattgaacagagttggggcagtcccaaagtaacaaaagatggtgtgactgtt
gcaaagtcaattgatttaaaagataaatataaaaatattggcgctaaacttgttcaagac
gttgccaataacacaaatgaagaggctggagatggcaccactactgctactgtcctggca
cgctctattgccaaggaaggcttcgagaagattagcaaaggtgctaatccagtggaaatc
aggagaggtgtgatgttagctgttgatgctgtaattgctgaacttaagaagcagtctaaa
cctgtgacaacccctgaagaaattgctcaggttgctaccatttctgcaaatggagataaa
gaaattggcaacatcatttctgatgcaatgaaaaaggttggaaggaaaggtgtcatcaca
gtaaaggatggaaaaacactaaatgatgaattagaaattattgaaggcatgaaatttgat
cgaggttatatttctccatactttattaatacatcaaaagggcagaaatgtgaattccaa
gatgcctatgttctgttgagtgaaaagaaaatttctagtgtccagtccattgtacctgct
cttgaaattgccaatgctcaccgtaagcccttggtcataattgctgaagatgttgatgga
gaagctctgagtacacttgttctgaataggctgaaagttggtcttcaggttgtagccgtc
aaagctccaggttttggtgacaatagaaagaaccagcttaaagatatggctattgctact
ggtggtgcagtgttcggagaagaagggttgactctaaatcttgaagatgttcagcctcat
gacttaggaaaagttggagaagtcattgtgaccaaagatgatgctatgctcttaaaagga
aaaggtgacaaggctcaaattgaaaaacgtatccaagaaatcattgaacagttagatatc
acaactagtgaatatgaaaaggaaaaactgaatgaacgtctggcaaaactctcagatgga
gtagctgtgctgaaggttggtggcacaagtgatgttgaagtgaatgaaaaaaaagacaga
gttacagatgccctcaatgctacccgagctgctgttgaagaaggcattgttctgggaggg
ggttgtgccctgcttcggtgcattccagccttggattcaataactccagctaatgaagat
caaaaaattggtatagaaatcattaagagaacactcaaaattcctgcaatgaccattgct
aagaatgcaggtgttgaaggatcattgatagttgagaaaattatgcagagttcctcagaa
gttggttatgatgctatgcttggagattttgtgaatatggtagaaaagggaatcattgat
ccaactaaggttgtaagaactgctttattggatgctgctggagtggcctctctgttaact
acagcagaagttgtagtcaccgaaattcctaaggaagagaaggaccctggaatgggcgga
atgggaggaatgggaggtggtatgggaggtggcatgttctaa

DBGET integrated database retrieval system