KEGG   Felis catus (domestic cat): 101088712
Entry
101088712         CDS       T02385                                 
Symbol
NCF2
Name
(RefSeq) neutrophil cytosol factor 2
  KO
K08010  neutrophil cytosolic factor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04380  Osteoclast differentiation
fca04613  Neutrophil extracellular trap formation
fca04670  Leukocyte transendothelial migration
fca05020  Prion disease
fca05140  Leishmaniasis
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088712 (NCF2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101088712 (NCF2)
   04670 Leukocyte transendothelial migration
    101088712 (NCF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101088712 (NCF2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101088712 (NCF2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101088712 (NCF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    101088712 (NCF2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088712 (NCF2)
   05418 Fluid shear stress and atherosclerosis
    101088712 (NCF2)
   05415 Diabetic cardiomyopathy
    101088712 (NCF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088712 (NCF2)
Membrane trafficking [BR:fca04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101088712 (NCF2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 TPR_2 TPR_1 PB1 TPR_12 TPR_8 TPR_16 TPR_9 TPR_17 Cohesin_load
Other DBs
NCBI-GeneID: 101088712
NCBI-ProteinID: XP_003999309
Ensembl: ENSFCAG00000025407
UniProt: M3X0B4
LinkDB
Position
F1:26721877..26755569
AA seq 526 aa
MSLAEAISLWNEGVLAADKKDWKGALDAFTAVQDPHSRICFNIGCMHTILENMPEAEKAF
TRSINRDKHLAVAYFQRGMLYYRIEKYDSAIKDLKEALTQLRGNQLIDYKILGLQFKLFA
CEVLYNVAFMYAKKEEWKKAEEHLALAMSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVG
RLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRAL
EGEAHRVLFGFVPETAEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPLELR
IHAQQQPQEEASPDSDIPAPPSSDAPGRPQLPPGQKGKEESKEVKLSIPMPYTLKVHFKY
TVVMETQPGLPYSQVRDMVSKKLELLPEHTRLSYRPRDSNELVPLSEENMKAAWAQVKNY
SLTVWCENTVGDQGFPDEPKESEKSEANNQTTEPQLKEGGQVVALFSYEATQPEDLEFQE
GDIIQVISMVNEDWLEGECKGKIGIFPKAFVEEHATTDMESSPRGV
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgtccctggctgaggccatcagcctctggaatgaaggggtgctggcagctgacaagaag
gattggaagggagccctggacgccttcactgcagtccaggacccccactccaggatttgc
ttcaacatcggctgcatgcacacaatcctggaaaacatgcccgaggcggagaaggccttc
accagaagcattaaccgagacaagcacttggcagtggcctacttccaaagagggatgctc
tattaccggatagagaaatatgattcagctatcaaagaccttaaagaggccttgactcag
cttcgagggaatcagctgatagactacaagattctggggctgcagttcaagttgtttgcc
tgtgaggtgttatataatgttgctttcatgtatgccaagaaggaggagtggaaaaaggct
gaggaacatttagctttggccatgagcatgaagtctgagccgagacattctaaaattgac
aaagccatggaatgtgtttggaaacagaagctgtatgagcctgtggtgatccctgtgggc
aggctgtttcgaccaaacgagaggcaagtggctcagctggccaagaaggattacctcggc
aaggcgacagtggtggcatctgtggtggatcaagacagtttctcggggtttgcccctctg
cagccacaggcagctgaacctccacccagacccaaaaccccagagatcttcagggctctg
gaaggggaagcccaccgtgtgctgtttgggtttgtgcctgagaccgcagaagagctgcag
gtcatgccagggaacatcgtttttgtcttgaagaagggcaatgataactgggctacggtc
atgttcaacggacagaaggggctcgttccctgcaactaccttgaaccacttgagctgcgg
atccatgctcagcagcagccccaggaggaagcctccccagattctgatatcccagctcct
cccagttctgatgctcccggaagaccccagttgccaccaggtcaaaaaggaaaagaagag
tccaaggaagtaaagctcagcattcccatgccctacacgctcaaggtgcacttcaagtac
acggtggtcatggagacgcagcccgggctcccctacagccaggtccgggacatggtgtct
aagaaactggagctcctgccggagcacactcggctgagttaccggcctcgggacagcaat
gagctggtgcccctctcggaagagaacatgaaggctgcctgggcccaggtgaaaaactac
agcctgactgtgtggtgtgagaacacagtgggtgaccaaggctttcctgacgaacccaag
gaaagtgaaaaatctgaagctaataaccagacaacagaacctcagcttaaggaaggaggc
caagtggtagcactcttcagttatgaggctacccagccagaagacctggagtttcaggaa
ggggacataatccaggttatatcaatggtgaatgaagactggctggaaggggagtgcaaa
gggaagattggcattttccccaaagcttttgttgaagaacacgcaactacggatatggaa
agctctcctagaggagtctag

DBGET integrated database retrieval system