KEGG   Felis catus (domestic cat): 101088766
Entry
101088766         CDS       T02385                                 
Symbol
SLC9A1
Name
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04371  Apelin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04919  Thyroid hormone signaling pathway
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101088766 (SLC9A1)
   04024 cAMP signaling pathway
    101088766 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101088766 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101088766 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101088766 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    101088766 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    101088766 (SLC9A1)
   04971 Gastric acid secretion
    101088766 (SLC9A1)
   04972 Pancreatic secretion
    101088766 (SLC9A1)
   04976 Bile secretion
    101088766 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101088766 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101088766 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101088766 (SLC9A1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101088766 (SLC9A1)
Transporters [BR:fca02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   101088766 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD DUF6114 OprF
Other DBs
NCBI-GeneID: 101088766
NCBI-ProteinID: XP_003989748
Ensembl: ENSFCAG00000010301
LinkDB
Position
C1:complement(20404896..20452865)
AA seq 816 aa
MMPLWSGVCGRSPPRIFPSLLMVVALVGLLPVLRSHGLQPSPTASTIRGSEPPRERSIGD
VTTAPPEIPPESRPVNHSVTEHSMKTRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGF
HVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPL
RQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDP
VAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDRVGIVDIVLGFLSFF
VVSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIAS
GVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLL
FCLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDL
FLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICG
HYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPS
AVSTVSMQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPY
EEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITI
DPASPQSPESVDLVNEELKGKVLGLNRDPARVVEEDEEDDGGIVMRTKEPSSPGTDDVFT
PGPSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgatgcctctgtggtcgggcgtctgtggccgctctcccccacgaatcttcccttcattg
ctcatggtggtagccttggtggggttgctaccggttctcaggagccatggcctccagccc
agtcctactgccagcaccatccgaggctcagagccaccacgggaacgctctattggggat
gtcaccaccgccccaccggagattccccccgagagccggcctgttaatcattccgtcact
gaacacagcatgaagactcgaaaggcctttccagtcctgggcatcgactacacacatgtg
cgcacaccctttgagatctcgctctggatcctgctggcctgcctcatgaagataggtttc
catgtgatccccactatctcgagcatcgtcccggagagctgcctgctgatcgtggtgggg
ctgctggtggggggcctgatcaagggcgtgggcgagacgccccccttcctgcaatccgac
gtcttcttcctcttcctgctgccgcccatcatcctggacgcgggctacttcctgccgctg
cggcagttcacagagaacctgggcaccatcctgatcttcgccgtggtgggcacactgtgg
aatgccttcttcctgggcggcctcatgtacgccgtgtgcctggtgggcggcgagcagatc
aacaacattggccttctggacaacctgctctttggcagcatcatctcagccgtggacccc
gtggccgtgctggccgtctttgaggaaattcacatcaatgagctgctgcatatccttgtc
tttggggagtccctgctcaatgacgccgtcactgtggtcctgtatcatctctttgaagag
tttgcaaactacgaccgagtgggcatcgtggacatcgtccttggcttcctgagcttcttc
gtggtgtccctgggcggggtgtttgtgggcgtggtctacggggtcatcgcagccttcacg
tcccgattcacctcccacatccgtgtcatcgagccgctcttcgtcttcctctacagctac
atggcctacctatcagccgagctcttccacctgtcgggtatcatggcactcattgcctcg
ggagtggtgatgcgcccctacgtggaggccaacatctcccacaagtcccacacgaccatc
aaatatttcctgaagatgtggagcagtgtcagtgagaccctcatctttatcttcctcggc
gtctccacggtggctggctcccaccactggaactggacctttgtcatcagcaccctgctc
ttctgcctcatcgcccgagtgctgggtgtgctgggcctgacctggttcatcaacaagttc
cgaattgtgaagctgacccccaaggaccagttcatcattgcctacggaggcctgcgaggg
gccatcgccttctccttgggctacctcctggacaagaagcacttccccatgtgtgacctg
ttcctcactgccatcatcactgtcatcttcttcaccgtctttgtgcagggcatgaccatt
cggcccctggtagacctgttggctgtgaagaaaaagcaagaaacaaagcgttctatcaac
gaggaaatccacacacagttcctggaccaccttctgacaggcatcgaggacatctgtggc
cactacggccaccaccactggaaggacaagctcaaccggtttaacaagaagtatgtgaag
aagtgtctgatagccggggagcgctccaaggagccacagctcatcgccttctaccacaag
atggagatgaagcaggccattgagctggtggagagcggtggcatgggcaagatcccttct
gctgtctccactgtctccatgcagaacatccaccccaagtccctgcctgccgagcgcatc
ctgccagctctgtccaaggacaaggaggaggagattcgcaaaatcctgaggaacaacttg
cagaagaccaggcagcggctgcggtcctacaacagacacacactggtggcagatccctat
gaggaggcctggaaccagatgctgctgcgcagacagaaggcccggcaactagagcagaag
atcaacaactacctgacggtgccggcccacaagctggactcacccaccatgtcgagggcc
cgcattggctcagaccccctggcctatgagccgaaggccgatttgcctgttatcaccatc
gacccagcctccccgcagtcgcccgagtctgtggacctggtgaacgaggagctgaagggc
aaggtcttggggctgaaccgggatccagcgagggtggtggaggaggacgaggaggacgat
gggggcattgtgatgcggaccaaggagccctcatccccaggcaccgatgatgtcttcacc
cctggaccaagtgacagccccagctcccagaggatacagcgctgccttagtgacccaggt
cctcaccctgagcctggggagggagagcctttcatccccaaggggcagtag

DBGET integrated database retrieval system