KEGG   Felis catus (domestic cat): 101088865
Entry
101088865         CDS       T02385                                 
Symbol
VCAM1
Name
(RefSeq) vascular cell adhesion protein 1 isoform X1
  KO
K06527  vascular cell adhesion molecule 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04514  Cell adhesion molecules
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05143  African trypanosomiasis
fca05144  Malaria
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101088865 (VCAM1)
   04668 TNF signaling pathway
    101088865 (VCAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101088865 (VCAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101088865 (VCAM1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101088865 (VCAM1)
   05143 African trypanosomiasis
    101088865 (VCAM1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088865 (VCAM1)
   05418 Fluid shear stress and atherosclerosis
    101088865 (VCAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101088865 (VCAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101088865 (VCAM1)
   04091 Lectins [BR:fca04091]
    101088865 (VCAM1)
CD molecules [BR:fca04090]
 Proteins
  101088865 (VCAM1)
Lectins [BR:fca04091]
 I-type lectins (Siglecs)
  101088865 (VCAM1)
SSDB
Motif
Pfam: I-set C2-set Ig_3 ig Ig_2 V-set C2-set_2 Ig_6 ICAM_N Ig_4 Ig_5 C1-set
Other DBs
NCBI-GeneID: 101088865
NCBI-ProteinID: XP_003990416
Ensembl: ENSFCAG00000011031
UniProt: M3WED4
LinkDB
Position
C1:86473032..86491367
AA seq 748 aa
MFSSQRQLKMPRKMFVIFGASNILWMVFTVSQAFKIETFPENKIVAQIGDVVSLTCRTTG
CELPSFSWRTHLDSPLNGQVRNEGSNSTLTMDPVGFRNEYSYLCTAICGSEKREKGIQVE
IYSFPKDPEIHLSGPLEVGKPVTVTCLVPDVYPFDRLEMNLLKGNHLLQNKDFVEPMERK
SLETKSLEVTFTPTNEDIGKALVCQAKLHIDEIDFKPKERETTKKLQVYISPKNTVISVN
PSTRLQEGGSVTMTCSSEGLPAPQIFWSKKLDNGNLQLLSGNSTLTLIAMRTEDSGIYVC
EGVNQVGKNGKEVELIVQEKPFTVEISPGPQIVAQIGDSVVLTCGVTGCESPSFTWRTQV
DSPLSGKVKTEGSKSTLTLSPVGFENEHSYLCTVTCGRKKVEKGIKVDLYSFPRDPEIEM
SGLPVNGNPVTISCRVPNVYPSDRLEIELLKGESIIGNKNFLENIDKKYLETESLDMTFI
PTTEDTGTVLVCLAKLHIDEMEFEPKQRQSTQTLYVNVAPRDTTILVSPSSILEEGSSVN
MTCSSNGLPAPKILWSRQLNNGHLQPLSENSTLTLTSTKMEDSGVYVCEGINQAGIDRKE
VELIIQVAPKDIQLTAFPSESVKEGDTVIISCTCGNVPKTWIILKKKAETGDTVLQSRDG
AYTIHKVQLEDAGVYECESKNEVGLQLRSLTLDVKGRGNYQDYFSPELLVLYCSSSLIIP
AIGMIIYFARRANMKGSYSLVEAQKSKV
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgttctcatcacagcgacaactaaaaatgcctaggaagatgtttgtgatctttggagct
tcaaatatactttggatggtgtttacagtttctcaagcttttaaaatagagaccttccct
gaaaacaaaattgttgctcagattggtgatgtcgtttcactgacttgcaggacaacaggc
tgtgagctcccatctttctcttggagaacccatttagatagtccactgaatgggcaggtg
agaaatgaggggtccaattccacgctgaccatggatcccgttggtttcaggaatgaatac
tcttacctgtgcacagcgatttgcggatctgagaaacgggaaaaagggattcaggtggag
atttactctttccctaaggacccagagatccatctgagtggccccctggaagttgggaag
ccagtcacagtcacatgcttggtccctgatgtttatccattcgacaggctggagatgaat
ttgctgaaaggcaaccatctcttacagaataaggactttgtagaacctatggaaagaaag
tccctggaaaccaagagtttggaggtaaccttcactcctaccaatgaagatattgggaaa
gctcttgtttgccaagcgaaattacacattgatgaaattgactttaagcccaaagaaagg
gagactacgaaaaaactgcaagtctacatctcacccaagaacacagttatctctgtgaat
ccctccacaaggctgcaggaaggtggttctgtgacaatgacatgctccagtgaaggtcta
ccagctccacagattttctggagcaaaaaattagataatgggaatctacagctcctttct
gggaactcaactctcactttaattgctatgaggacagaagattctggaatttatgtgtgt
gaaggagtcaatcaagttgggaaaaatggaaaagaggtggaattaattgttcaagagaaa
ccattcactgttgagatctcccccgggccccagattgttgctcagattggtgactcagtt
gtgttgacatgtggtgtcacaggctgtgagtccccatctttcacttggagaacccaggta
gacagccctctgagtgggaaggtgaagactgaagggagcaagtccacgctgaccctgagc
cctgtgggttttgagaatgaacattcttatctgtgcaccgtaacctgtggccgtaagaaa
gtggaaaagggaattaaagtggatctctactcattccctagagatccagagattgagatg
agtggtctgcctgtgaatggaaacccggtgactataagctgccgggttcctaatgtgtat
ccttctgaccggctggagattgaattacttaagggggagagtattatagggaataaaaat
tttctggagaacatagacaagaagtatctagagactgagagtttggacatgaccttcatc
cccaccactgaagatactggaaccgttcttgtttgtctggctaagttacatattgatgaa
atggaatttgaacccaaacaaaggcagagtacacagacactttatgttaatgttgccccc
agggatacaaccatcttggtcagcccctcctccatcctggaggaaggtagttctgtgaat
atgacatgctccagcaatggccttccagctccaaaaatcctctggagcaggcagctaaac
aatgggcatctacagcctctttctgaaaattcaactctcaccttaacttctacaaaaatg
gaagactctggtgtttatgtgtgtgaagggattaaccaggctggaatagacagaaaagaa
gtcgaattaattatccaagttgctccgaaagacatacaacttacagcttttccttctgag
agtgtcaaggaaggagacactgttattatctcctgtacatgtggaaatgttcccaaaact
tggataatcctgaagaaaaaagcagagacgggagacacagtgctacagtccagagatggt
gcatataccatccacaaggtccagttagaggacgctggagtgtacgaatgtgaatctaaa
aatgaggttggcttgcaattaagaagtttaacccttgatgttaaaggaagaggaaattac
caggactatttttctcctgaacttctcgtgctctattgttcatcttccttaataatacca
gccattggaatgatcatttactttgctagaagagccaacatgaaagggtcatacagtctt
gtagaagcacagaaatcaaaggtgtag

DBGET integrated database retrieval system