KEGG   Felis catus (domestic cat): 101089032
Entry
101089032         CDS       T02385                                 
Symbol
CCL20
Name
(RefSeq) C-C motif chemokine 20 isoform X1
  KO
K14625  C-C motif chemokine 20
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101089032 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089032 (CCL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101089032 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101089032 (CCL20)
   04062 Chemokine signaling pathway
    101089032 (CCL20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101089032 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101089032 (CCL20)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101089032 (CCL20)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101089032
NCBI-ProteinID: XP_003991274
Ensembl: ENSFCAG00000003413
UniProt: M3W0B0
LinkDB
Position
C1:211697369..211700916
AA seq 97 aa
MMDSGKNLLLAALMSVLLLHLCSKSEAASSFDCCLRYTERILHPRFIVGFTQQLSNEACD
INAIIFYTKKKFAVCADPKKNWVKQAVHILSQRVKKM
NT seq 294 nt   +upstreamnt  +downstreamnt
atgatggacagtggcaagaatttgctcttggctgctttgatgtcagtgctgctactccac
ctgtgcagcaagtcagaagcagcaagcagctttgactgctgccttcggtatacagaacgc
atccttcatcccagatttatcgtgggcttcacgcagcagctgtccaatgaagcctgtgat
atcaatgcaatcatcttttacacaaagaaaaaattcgcggtgtgcgcagatccaaagaag
aattgggtgaaacaggctgtgcatatcctcagccaaagagtcaagaagatgtaa

DBGET integrated database retrieval system