KEGG   Felis catus (domestic cat): 101089072
Entry
101089072         CDS       T02385                                 
Symbol
HSPA9
Name
(RefSeq) stress-70 protein, mitochondrial
  KO
K04043  molecular chaperone DnaK
Organism
fca  Felis catus (domestic cat)
Pathway
fca03018  RNA degradation
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101089072 (HSPA9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101089072 (HSPA9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101089072 (HSPA9)
   03110 Chaperones and folding catalysts [BR:fca03110]
    101089072 (HSPA9)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101089072 (HSPA9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089072 (HSPA9)
Messenger RNA biogenesis [BR:fca03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     101089072 (HSPA9)
Chaperones and folding catalysts [BR:fca03110]
 Heat shock proteins
  HSP70 / DNAK
   101089072 (HSPA9)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    101089072 (HSPA9)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    101089072 (HSPA9)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101089072 (HSPA9)
  Exosomal proteins of breast cancer cells
   101089072 (HSPA9)
  Exosomal proteins of colorectal cancer cells
   101089072 (HSPA9)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA
Other DBs
NCBI-GeneID: 101089072
NCBI-ProteinID: XP_003980861
Ensembl: ENSFCAG00000001718
UniProt: M3VX55
LinkDB
Position
A1:complement(117107411..117124881)
AA seq 679 aa
MISASRAAAARLVGAAVSRGPTAARPKDGWNGLSHEAFRIVSRRDYASEAIKGAVVGIDL
GTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYAT
KRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAEN
YLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKII
AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVREFKRETGVDLTK
DNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIK
RTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG
AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQT
QVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTG
REQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFK
DQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASERE
GSGSSGTGEQKEDQKEEKQ
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgataagtgccagccgggccgcagcagctcgtctcgtcggcgccgcggtctcccggggc
cccacagccgcccgccccaaggatggctggaatggccttagtcatgaggcttttagaatt
gtttcaaggcgggactatgcatcagaagcaatcaagggagcagttgttggtattgatttg
ggcactaccaactcttgtgtggcagttatggaaggtaaacaagcaaaggtgctagagaat
gctgaaggtgccagaaccaccccttcagttgtggcctttacagcagatggtgagcgactt
gttggcatgccagccaagcgacaggctgtcactaacccaaacaacacattctatgccacc
aagcgtctcattggccggcgatatgatgaccctgaagtacagaaagacattaaaaatgtg
ccctttaaaattgtccgtgcctccaatggagatgcctgggtcgaagctcacggaaaactc
tattctccaagtcagattggagcatttgtgttgatgaaaatgaaagagactgcagaaaat
tacttggggcatacagcaaaaaatgctgtgatcacagttccagcttatttcaatgactcc
cagagacaggccactaaagatgctggccagatatctggactaaacgtgcttcgggtaatt
aatgaacctacagccgctgctctggcttatggtctagacaaatcagaagataaaataatt
gctgtatatgatttaggtggtggaacttttgatatttctatcctggaaattcagaaagga
gtgtttgaggtgaagtctaccaatggagacacgttcttaggtggtgaagactttgaccag
gccttgctacgacacattgtgagggagttcaagagagagacgggggttgatttgaccaaa
gacaacatggcacttcagagggttcgggaagctgctgagaaggctaagtgtgaactctcc
tcatctgtgcagaccgacatcaatttgccatatcttacaatggatgcttctggacccaag
catttgaatatgaagctgacccgggctcaatttgaagggattgttacggatctaatcaag
aggacaattgccccatgtcaaaaagccatgcaagatgcagaagtcagcaagagtgacata
ggagaagtgattcttgttggtggcatgactaggatgcccaaggttcagcagactgtacaa
gatctctttggccgagccccaagcaaagcagtcaatcctgatgaggctgtggccattgga
gctgccattcagggaggtgtgttagctggtgatgtcacagatgtgctgctcctggatgtc
actcccctgtctctgggtattgagactctgggaggtgtttttaccaaacttatcaacaga
aacaccactattccaaccaagaaaagccaggtgttttctacagctgctgatggtcagact
caagtggagattaaagtgtgtcagggtgagagagagatggctggagacaacaaacttctt
ggacagtttactttgattgggattcccccagcccctcgtggagtccctcagattgaagtt
acatttgacattgatgccaatgggattgtacatgtttcagccaaagataagggcacagga
cgtgagcagcagattgtgatccagtcttctggtgggttaagcaaagatgatattgaaaat
atggttaaaaatgcagaaaagtatgctgaggaagaccgacgaaagaaggaacgagttgaa
gcagttaatatggctgaaggaatcattcatgacacagaaacaaaaatggaagaattcaag
gaccagttgcctgctgatgaatgcaacaagctaaaagaagagatttccaaaatgagggaa
cttctggctcgaaaagacagtgaaacgggagaaaacataaggcaggcagcatcttccctt
cagcaagcatcactgaagctcttcgaaatggcatacaaaaagatggcatctgagcgagaa
ggctctggaagttctggcactggggaacaaaaggaagatcaaaaggaggagaaacagtaa

DBGET integrated database retrieval system