KEGG   Felis catus (domestic cat): 101089305
Entry
101089305         CDS       T02385                                 
Symbol
TNFRSF13B
Name
(RefSeq) tumor necrosis factor receptor superfamily member 13B isoform X1
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04672  Intestinal immune network for IgA production
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089305 (TNFRSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101089305 (TNFRSF13B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101089305 (TNFRSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089305 (TNFRSF13B)
   04090 CD molecules [BR:fca04090]
    101089305 (TNFRSF13B)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101089305 (TNFRSF13B)
CD molecules [BR:fca04090]
 Proteins
  101089305 (TNFRSF13B)
SSDB
Motif
Pfam: TACI-CRD2 BCMA-Tall_bind BaffR-Tall_bind
Other DBs
NCBI-GeneID: 101089305
NCBI-ProteinID: XP_023099784
Ensembl: ENSFCAG00000007049
LinkDB
Position
E1:12471815..12507959
AA seq 289 aa
MSGLGRSRRGGRTRAGPEWSPQGLRMGVAMGQCPEEQYWDPLLNICLSCKLICSHQIPRT
CAAFCKSLSCHKEQGRYYDQLLRDCISCASICGRHPKQCTYFCENKFRSHANLPPELRRQ
RAGEAETRPDDLGRYQGTEHRGSEPVPGLKLSADQLALVYSTLGLCLCAIICCFLLAVAC
FLKRRGDQFSCQPSPAPCQTQAKSSKDHWMEAGSAEGALPEPVETCSFCFPERRQPTQES
AGGPGTPGAARSGRWGRLGRTTIGQPCARAPEGGLEVLCAPAEEGGPTS
NT seq 870 nt   +upstreamnt  +downstreamnt
atgagtggcttgggccggagcaggcgaggtggccggacccgggcgggcccggagtggtct
ccacagggcctgcggatgggggtggccatgggtcagtgccccgaagaacagtactgggat
cccctactgaacatctgcctctcctgcaaactcatctgcagccatcagattccacgcacc
tgtgcagcattctgcaagtcactcagctgccacaaggagcaaggcaggtactacgaccag
ctcctgagggactgcatcagctgcgcctccatctgcggacgtcaccccaagcaatgcacg
tacttctgtgagaacaagttcaggagccacgcgaacctcccgccggagctcaggagacag
cgggccggggaagcggaaaccaggccagacgacttggggaggtaccagggaacagagcac
agaggctccgagccggttccagggctgaagctgagcgccgaccagctggccctggtctac
agcacactggggctctgcctctgtgccatcatctgctgcttcctcctggccgtggcctgc
ttcctcaagaggagaggggaccagttctcctgccagccctcaccggcaccgtgtcagacc
caggccaagtcctccaaggatcactggatggaagctggaagcgccgagggcgcgttgcca
gagccagtggagacgtgcagcttctgcttcccggagcgcaggcagcccacccaggagagc
gcgggcgggcccgggaccccgggcgccgcgcgctctgggaggtgggggcgcctcggccgg
accacgatcggacagccgtgcgcgcgcgcccccgaaggcggccttgaggtcctgtgcgct
cctgcggaggagggaggcccgacctcgtga

DBGET integrated database retrieval system